US11940694B2
A method for manufacturing a light modulation device is provided. The light modulation device is capable of removing defects such as orientation irregularities. The light modulation device further improves the orientation state in the light modulation device that adjusts orientation of a liquid crystal compound or the like with a liquid crystal alignment film and a pressure-sensitive adhesive layer or adhesive layer.
US11940679B2
An apparatus is disclosed that includes a switchable optical filter having a layer of switchable material; a light source providing light of a wavelength that causes the switchable material to transition from a faded state to a dark state, or a dark state to a faded state; and a switch for controlling activation of the light source.
US11940677B1
An optical device including a waveguide, electrodes, and a connecting dielectric is described. The waveguide includes an electro-optic material having a waveguide optical refractive index and a waveguide microwave dielectric constant. The electrodes include a first electrode and a second electrode. The waveguide is between the first electrode and the second electrode. At least a portion of the connecting dielectric is between the waveguide and electrodes. The connecting dielectric has a microwave dielectric constant greater than the waveguide microwave dielectric constant.
US11940664B2
A lens unit includes a jointed lens having a first optical member, a second optical member disposed on an optical axis of the first optical member, and a jointing member having a light transmissive property and disposed between the first optical member and the second optical member, and a holding mechanism configured to hold the first and second optical members. The holding mechanism holds the first and second optical members so that a distance along an optical axis direction between a first lateral surface at an opposite side to a second optical member side in the first optical member and a second lateral surface at an opposite side to a first optical member side in the second optical member becomes a preset distance. The jointing member adheres to the first optical member and the second optical member so that the distance becomes the preset distance.
US11940663B2
An optical device includes a core formed on a substrate, a first source electrode and a second source electrode formed in contact with both side surfaces of the core interposed between the first source electrode and the second source electrode, and a drain electrode formed in contact with an upper surface of the core. The core, the first source electrode, and the second source electrode together form a plasmonic waveguide. The first source electrode and the second source electrode are Schottky coupled to the core.
US11940649B2
An optical fiber bundle structure includes: plural optical fiber core wires; a crossing preventing member; and a grasping member. Further, the crossing preventing member has slits and the widths of the slits positioned at the respective sides are each equal to or larger than a difference between: a length of one side of a polygon circumscribing the plural optical fiber core wires at a hindmost end portion of the slits at the trailing end; and a length of one side of a polygon circumscribing the plural optical fiber core wires at the leading end.
US11940648B2
Methods are known for producing an anti-resonant hollow-core fiber which has a hollow core extending along a fiber longitudinal axis and an inner jacket region that surrounds the hollow core, said jacket region comprising multiple anti-resonant elements. The known methods have the steps of: providing a cladding tube that has a cladding tube inner bore and a cladding tube longitudinal axis along which a cladding tube wall extends that is delimited by an interior and an exterior; providing a number of tubular anti-resonant element preforms; arranging the anti-resonant element preforms at target positions of the interior of the cladding tube wall, thereby forming a primary preform which has a hollow core region and an inner jacket region; further processing the primary preform in order to form a secondary preform, including an elongation process; and drawing the secondary preform in order to form the hollow-core fiber. The aim of the invention is to achieve a high degree of precision and an exact positioning of the anti-resonant elements in a sufficiently stable and reproducible manner on the basis of the aforementioned methods. This is achieved in that after the primary preform is elongated, at least some of the formerly tubular anti-resonant element preforms of the primary preform have an oval outer cross-sectional shape with a longest cross-sectional axis AL and a shortest cross-sectional axis AK, wherein the ratio AL/AK of the length of the axes ranges from 1.01 to 1.27, and the shortest cross-sectional axis AK runs in a radial direction when viewed from the cladding tube longitudinal axis.
US11940642B2
An illumination device for fluorescence image guided surgery and a surgical instrument. The illumination device includes a glass rod, a mixing rod and a plurality of optical fibers surrounding a circumferential surface of the glass rod. A first mixing rod end face of the mixing rod abuts a second rod end face of the glass rod and end faces of the optical fibers, so that white light and excitation light are guided and homogenized in the mixing rod.
US11940641B2
A light pipe includes at least two optical structures having different refractive indices. An interface between the two optical structures is oblique to a longitudinal axis of the light pipe such that an output ray from an output surface at a distal end of the light pipe is non-parallel to an input ray that is parallel to the longitudinal axis at an input surface at a proximal end of the light pipe. Light refracts inside the light pipe between the (at least) two optical structures altering the direction of an optical path of the light through the light pipe, thereby allowing higher degrees of freedom for the selection of the angle of deviation (folding angle) of the light pipe. By optimizing various parameters of the light pipe, a desired output optical axis angle (i.e., folding angle) can be achieved that suits the desired optical engine envelope.
US11940628B2
Examples are disclosed that relate to display devices having a common light path region. One example provides a display device comprising a light source configured to emit illumination light along an illumination path, and a spatial light modulator configured to modulate the illumination light and emit the modulated illumination light as image light along an imaging path, wherein at least a portion of the illumination path and at least a portion of the imaging path extend through a common light path region. The display device further comprises one or more optical elements positioned within the common light path region, at least one optical element being configured to guide the illumination light as the illumination light travels through the common light path region toward the spatial light modulator, and shape the image light as the image light travels through the common light path region.
US11940626B1
Devices/techniques coupleable to patient sensors, ambient environment, and external sensory input. Devices/techniques receive/maintain information; correlate received/maintained information with measures associated with detecting/monitoring, predict, prevent/treat, and train/reward patient self-care, for dry eyes. Devices/techniques detect/monitor, predict, and prevent/treat dry eyes in real time; and train/reward patients to conduct self-care for dry eyes. The devices/techniques provide adjusted sensory inputs to prevent/treat dry eyes, or to train/reward patients to conduct self-care for dry eyes. The devices/techniques cooperate with other devices, including devices worn by nearby patients, to receive/maintain information about the ambient environment, or communicate with medical personnel. The devices/techniques adjust parameters they use, in response to received information that differs from predictions, to provide superior behavior, and communicate with other devices and medical personnel. Devices/techniques are combined with devices/techniques that perform similar functions for other conditions, migraines/photophobia, neuro-opthalmic disorders, and other ocular conditions, and for combinations of dry eyes with other conditions.
US11940622B2
Data characterizing a relative arrangement of vehicle occupants with respect to one another are continuously transmitted to display devices worn on the heads of the vehicle occupants. Virtual environments are displayed as a function of these data.
US11940613B2
An apparatus and method are provided for a night vision system including a transparent overlay display that transmit direct-view light representing an intensified image and emits display light representing a display image. The overlay display includes photodetectors arranged to detect an intensity of the incoming direct-view light, and an intensity of the display light depends on the detected intensity. In some embodiments, the intensity of the display light is spatially modulated using an amplitude or envelope of the intensity that is based on the detected local intensity of the direct-view light. In some embodiments, the intensity of the display light is adjusted to correct for loss of the direct-view light. The intensity of the display light may be controlled using control circuitry that receives signals from the photodetectors, and the control circuitry may be located on the same semiconductor chip as the overlay display.
US11940611B2
Disclosed herein are methods of tomographic imaging, the methods comprising emitting a beam of light from a light source to a sample and modulating the beam of light through a spatial light modulator configured to convert the beam of light to an Airy beam. The spatial light modulator can be rotatable and positioned at a first angle relative to the sample. The method can further obtain a first perspective view of the sample, rotate the spatial light modulator to a second angle relative to the sample, and obtain a second perspective view of the sample. Each of the perspective views can be generated by the Airy beam interacting with the sample on a focal plane. The method can then reconstruct a volumetric three-dimensional view of the sample using the first perspective view and the second perspective view.
US11940610B2
An autofocus system includes a focus light source, an objective lens, a defocus lens, a first image sensor, and a controller. The defocus lens is disposed on the transmission path of the focus light beam, so that a minimum light point of the focus light beam passing through the objective lens deviates from a focus of the objective lens. The first image sensor is configured to receive a focus reflected light beam generated after the focus light beam is reflected by the sample. The controller is electrically connected to the first image sensor. According to a center change of gravity, a position change, or an energy change of a light spot formed by the focus reflected light beam on an image plane of the first image sensor, the controller drives the objective lens or the sample to move, so that the focus of the objective lens falls on the sample.
US11940599B2
An optical imaging system includes a first lens having a convex image-side surface, a second lens having a concave object-side surface, a third lens, a fourth lens, and a fifth lens disposed sequentially from an object side. The optical imaging system satisfies 4.8
US11940596B2
A spectacle lens has on at least one surface thereof at least two coatings modified to exhibit an antibacterial effect and/or an antiviral effect. A method of making such a spectacle lens includes dispersing at least one biocidal component in a solvent and/or dissolving at least one biocidal component in a solvent, the dispersed at least one biocidal component and the dissolved at least one biocidal component being different from each other.
US11940588B2
Methods and systems are provided for clay detection, clay typing, and clay volume quantification using downhole electromagnetic measurements conducted by a downhole logging tool on a formation at a low frequency less than 5000 Hz. The downhole electromagnetic measurements are used to determine permittivity data that characterizes permittivity of the formation at the low frequency less than 5000 Hz. The downhole low frequency electromagnetic measurements are nondestructive, and the results indicate it is with high sensitivity to the existence of clays.
US11940587B2
Systems and methods of the present disclosure relate to calibration of resistivity logging tool. A method to calibrate a resistivity logging tool comprises disposing the resistivity logging tool into a formation; acquiring a signal at each logging point with the resistivity logging tool; assuming a formation model for a first set of continuous logging points in the formation; inverting all of the signals for unknown model parameters of the formation model, wherein the formation model is the same for all of the continuous logging points in the first set; assigning at least one calibration coefficient to each type of signal, wherein the calibration coefficients are the same for the first set; and building an unknown vector that includes the unknown model parameters and the calibration coefficients, to calibrate the resistivity logging tool.
US11940580B2
A system for near-surface geophysical subsurface imaging for detecting and characterizing subsurface heterogeneities comprises an instrument that outputs probing electromagnetic signals through a ground surface that interact and are affected by scattered signals of acoustic waves that travel through the ground surface and further senses vibrational modes of a subsurface below the ground surface; an imaging device that dynamically generates a time sequence of images of properties of the acoustic waves and maps elastic wave fields of the acoustic waves; and a processor that analyzes dynamic multi-wave data of the images to quantify spatial variations in the mechanical and viscoelastic properties of the subsurface.
US11940556B2
A testing device for testing a distance sensor includes: a receiver for receiving an electromagnetic free-space wave as a receive signal; an analog-to-digital converter configured to, in a simulation mode, convert the receive signal into a sampled signal; a signal-processing unit configured to: delay the sampled signal or a modulated sampled signal to form a delayed sampled signal or a modulated delayed sampled signal; and modulate, upon the sampled signal or upon the delayed sampled signal, a predeterminable Doppler signature as a characteristic motion profile of a reflecting object to be simulated to form the modulated sampled signal or the modulated delayed sample signal; a digital-to-analog converter configured to convert the modulated or the modulated delayed sampled signal into a simulated reflected signal; and a transmitter configured to radiate the simulated reflected signal or a simulated reflected signal derived from the simulated reflected signal as an output signal.
US11940539B2
An automatic calibration and validation pipeline is disclosed to estimate and evaluate the accuracy of extrinsic parameters of a camera-to-LiDAR coordinate transformation. In an embodiment, an automated and unsupervised calibration procedure is employed where the computed rotational and translational parameters (“extrinsic parameters”) of the camera-to-LiDAR coordinate transformation are automatically estimated and validated, and upper bounds on the accuracy of the extrinsic parameters are set. The calibration procedure combines three-dimensional (3D) plane, vector and point correspondences to determine the extrinsic parameters, and the resulting coordinate transformation is validated by analyzing the projection of a filtered point cloud including a validation target in the image space. A single camera image and LiDAR scan (a “single shot”) are used to calibrate and validate the extrinsic parameters. In addition to only requiring a single shot, the complete procedure solely relies on one or more planar calibration targets and simple geometrical validation targets.
US11940535B2
A multipulse LIDAR system, including: a transmitting device for generating a transmission laser beam from a temporal sequence of single laser pulses; a receiving device with a detection surface, including a subdetector system made up of multiple subdetectors, for receiving the transmission laser beam that is reflected/scattered on objects in an observation area, the receiving device imaging a sampling point on the detection surface in the form of a pixel; a scanning device generating a scanning movement for successive sampling of the observation area along multiple sampling points situated in succession, the scanning movement to image a pixel on the detection surface, in each case shifted along the subdetector system; and a control device for determining distance information of the sampling points based on propagation times of the particular single laser pulses, the control device grouping subdetectors to form a macropixel individually associated with the particular pixel, for shared evaluation.
US11940527B2
A synthetic visual system for an aircraft may comprise: a camera in electronic communication with a controller; a radar system in electronic communication with the controller; a three-dimensional cockpit display in electronic communication with the controller via a synthetic weather system; and a tangible, non-transitory memory configured to communicate with the controller. The three-dimensional cockpit display may be configured to display a three-dimensional weather image based on correlated data between the radar system and the camera.
US11940525B2
An example method to determine an object spin rate may include receiving a radar signal of a particular object in motion. The method may further include converting the radar signal into an input vector. The method may also include providing the input vector as input to a neural network. The neural network may include access to a set of initial data that has been generated based on multiple initial radar signals of multiple initial objects in motion. The method may further include determining a spin rate of the particular object in motion based on an analysis performed by the neural network of the input vector including time and frequency information of the particular object in motion in view of the set of initial data. The analysis may include comparing one or more elements of the input vector to one or more elements of the set of initial data.
US11940516B2
A method for magnetic resonance imaging (MRI) may include obtaining imaging signals related to a region of interest (ROI) of a subject. The method may also include selecting a portion of the imaging signals as auxiliary signals associated with at least one temporal dimension of the ROI. The method may also include generating at least one target image associated with the at least one temporal dimension of the ROI based on the imaging signals and the auxiliary signals.
US11940515B2
A system, method, and computer-readable medium for evaluating structural integrity of a gradient coil disposed in a magnetic resonance imaging system is provided. A sensor obtains a parameter reading of the gradient coil, wherein the parameter reading includes a back electromotive force (back EMF) measurement. The structural integrity of the gradient coil is determined as function of the back EMF measurement.
US11940513B2
A magnetic resonance tomography unit and a method for operating the magnetic resonance tomography unit are provided. The magnetic resonance tomography unit has a transmission interference suppression device with a transmission interference suppression control system, a sensor, and a transmission interference suppression antenna. The transmission interference suppression device is configured to acquire, with the sensor, an excitation signal of the transmitter, and determine, with the transmission interference suppression control system, a transmission interference suppression signal dependent upon the acquired excitation signal of the transmitter. The transmission interference suppression device is configured to transmit, via the transmission interference suppression antenna, the transmission interference suppression signal, so that at a predetermined location outside the magnetic resonance tomography unit, the excitation signal emitted by the transmitter via the transmitter antenna is attenuated.
US11940510B2
A method for preparing an NMR material, comprising generating parahydrogen in gas or liquid form at a first location; transporting the parahydrogen away from the first location; mixing a precursor compound including a metabolite component with a catalyst for hydrogenation; hydrogenating the precursor compound using the parahydrogen; transferring polarization in the precursor compound to a nuclear spin of the metabolite component; cleaving a side arm of the precursor compound in a chemical reaction, with the metabolite molecule being one of the products of the reaction; separating the metabolite molecule from the catalyst for hydrogenation and other products of the reaction; and generating metabolite molecules for use in an MRI scanner by extracting a sample of the metabolite molecule having at least 5% polarization.
US11940509B2
A magnetometer includes a magnetically isolated chamber having an opening to receive a sample; one or more Optically Pumped Magnetometer (OPM) sensors positioned inside the magnetically isolated chamber; an actuator mounted on a frame, the actuator moving an end portion in and out of the magnetically isolated chamber; and a sample holder coupled to the end portion.
US11940504B2
A Hall effect sensor system includes a Hall effect sensor and a drive-sense circuit (DSC). The Hall effect sensor includes an input port to receive a DC (direct current) current signal and generates a Hall voltage based on exposure to a magnetic field. The DSC generates the DC current signal based on a reference signal and drives it via a single line that operably couples the DSC to the Hall effect sensor and simultaneously to sense the DC current signal via the single line. The DSC detects an effect on the DC current signal corresponding to the Hall voltage that is generated across the Hall effect sensor based on exposure of the Hall effect sensor to the magnetic field and generates a digital signal representative of the Hall voltage.
US11940503B2
A magnetic sensor circuit includes: a first element including series-connected resistor and capacitor, or including only a capacitor; a second element including series-connected resistor and inductor, or including a magnetic sensor sensing a magnetic field by a magnetic impedance effect; a third element including series-connected resistor and capacitor, or including only a capacitor; and a fourth element including a magnetic sensor sensing a magnetic field by a magnetic impedance effect, wherein a first series circuit part including the series-connected first and second elements and a second series circuit part including the series-connected third and fourth elements are connected in parallel, and, when the magnetic field sensed by the magnetic sensor has a predetermined reference value, a product of impedance Z1 of the first element and impedance Z4 of the fourth element and a product of impedance Z2 of the second element and impedance Z3 of the third element are equal.
US11940490B2
The disclosure provides a method and apparatus of interleaved on-chip testing. The method merges a test setup for analog components with a test setup for digital components and then interleaves the execution of the digital components with the analog components. This provides concurrency via a unified mode of operation. The apparatus includes a system-on-chip test access port (SoC TAP) in communication with a memory test access port (MTAP). A built-in self-test (BIST) controller communicates with the MTAP, a physical layer, and a memory. A multiplexer is in communication with the memory and a phase locked loop (PLL) through an AND gate.
US11940481B2
Embodiments relate to a test method for testing an unpopulated printed circuit board. The method can involve the steps of: exposing the unpopulated printed circuit board to temperatures of a reflow soldering process in a first step; and testing the electrical connections of the unpopulated printed circuit board. Embodiments also relate to a test device and a method for producing populated printed circuit boards.
US11940480B2
An apparatus includes a test head frame and a tray slidably coupled to the frame and configured to receive a printed circuit board (PCB) to be tested. The PCB is positioned within the frame when the tray is in a retracted position and outside the frame when the tray is in an ejected position. A bed of nails (BON) opposes a lower side of the PCB and includes a plurality of pins having first portions arranged on an upper side of the BON to connect with corresponding electrical pads on the lower side of the PCB when the tray containing the PCB is in the retracted position. A plurality of interface printed circuit boards is configured for connection to second portions of the plurality of pins exposed on a lower side of the BON and for receiving test signals when the tray containing the PCB is in the retracted position.
US11940477B2
A method of determining electromagnetic exposure values for radiative compliance tests a transmitting device with multiple transmitters or antenna. The device transmits a first set of excitation signals that are chosen in advance. These signals are measured for their electromagnetic exposure values. A second set of excitation signals are then transmitted that are adaptively chosen based on result of a previous measurements of the first excitation signals. The second set of signals are also measured. From the measurements of the predetermined and adaptive signals, the electromagnetic exposure values of all possible transmitted signals are inferred.
US11940476B2
A three-phase power meter can monitor power on both 3-wire and 4-wire power lines. The power meter measures at least two voltages between phase conductors of the power line, and at least one voltage between a phase conductor and a neutral conductor of the power line when the neutral conductor is available. Using at least some of the measured voltages, the power meter can then operate in a first mode when coupled to a 3-wire power line to determine power on the power line based on the measured voltages, or operate in a second mode when coupled to a 4-wire power line to determine power on the power line based on the measured voltages.
US11940465B2
A contact probe includes a first plunger, a second plunger, a coil spring, and a pipe; the first plunger includes a first slide portion that slides along the inner periphery of the pipe; the second plunger includes a second slide portion that slides along the inner periphery of the pipe; and the coil spring includes: a first attachment portion that is attached to the first plunger and tightly wound; a second attachment portion that is attached to the second plunger and tightly wound; a coarsely wound portion; a first contact portion including one end connected to the first attachment portion and another end connected to the coarsely wound portion and contacting the pipe; and a second contact portion including one end connected to the coarsely wound portion and another end connected to the second attachment portion and contacting to the pipe.
US11940455B2
A consumable management system comprising a consumable storage cluster with a plurality of storage compartments is presented. Each storage compartment is configured to receive one or more consumables. The consumable management system further comprises storage compartment indicators to provide guidance to a user and a detection unit for validating user action(s).
US11940454B2
Analyte collection and testing systems and methods, and more particularly to disposable oral fluid collection and testing systems and methods. Described herein are methods and apparatuses to achieve significant improvements in the detection of fluorescence signals in the reader.
US11940449B2
Compositions and methods for immunological detection of coronavirus antibodies are provided.
US11940448B2
Early detection of lysosomal storage diseases (LSDs) including Mucopolysaccharidosis Type I (MPS I) and Pompe Disease can greatly improve patient outcome as each disease can be fatal once symptoms emerge. Screening for MPS I and Pompe Disease using biological samples including dried blood spots (DBS), buccal swab, peripheral blood mononuclear cells (PBMCs), or white blood cells (WBCs) is described. The disclosed methods and assays provide a robust way to screen newborns for LSDs. The disclosed methods and assays can also allow rapid prediction of whether a patient with LSD will develop an immune response to enzyme replacement therapy (ERT), thus improving treatment for patients with LSDs. The disclosed methods and assays can also further reduce the number of false positives caused by pseudo deficiency cases of LSD, such as MPS I and Pompe Disease.
US11940446B2
A method for manufacturing a structure for microbe detection comprises the steps of: reacting nitrilotriacetic acid (NTA) and an acid anhydride to prepare a first compound; chelation of metal ions to the first compound to prepare a second compound; binding the second compound and a microbe detector to prepare a third compound; and mixing an exfoliated transition metal-dichalcogenide (TMD) compound and the third compound to prepare a structure for microbe detection, in which the metal ions of the third compound are bound with the transition metal-dichalcogenide compound.
US11940436B1
The present disclosure discloses an electroanalytical sensor for the detection of meloxicam. The electroanalytical sensor comprises a carbon electrode. The carbon electrode comprises zinc oxide (ZnO) nanoparticles, wherein the ZnO nanoparticles are co-doped with silver (Ag) and cobalt (Co). The present disclosure also discloses a method of detecting meloxicam using an electroanalytical sensor. The electroanalytical sensor comprises a carbon electrode, the carbon electrode comprising zinc oxide (ZnO) nanoparticles co-doped with silver (Ag) and cobalt (Co). The method of detecting meloxicam comprises the step of positioning a liquid droplet, comprising solvent, to be tested on a surface of the electrode. The method further comprises receiving a voltammetric response from the electrode, and analysing the voltammetric response to determine if meloxicam is present in the liquid droplet.
US11940433B1
A method includes receiving data characterizing a time-dependent first sensor data detected by a first sensor, a time-dependent second sensor data detected by a second sensor, a time-dependent third sensor data detected by a third sensor, a first set of threshold values associated with the first sensor, a second set of threshold values associated with the second sensor, and a third set of threshold values associated with the third sensor and a time window. The first, second, and third sensors are located in a first space of a building. The method further includes calculating a first performance index, a second performance index, and a third performance index. The method also includes classifying the first performance index, the second performance index, and the third performance index into one of a plurality of performance indicators. The method further includes assigning a performance rating score for a space based on the classification.
US11940423B2
To suppress the influence of heat from an interface part on temperature control of a separation column and also to suppress the influence of room temperature fluctuation outside a main body. A gas chromatograph (1) includes a main body (2) having internal space, a column cartridge (4) disposed in the internal space of the main body (2) and including a case (20), a heater (18) and a separation column (16) for separating components in sample gas, the separation column being accommodated in the case (20) together with the heater (18), and the case (20) being provided with an intake port (26) through which air for cooling the separation column (16) is taken into the case (20), a sample gas supplier (6) for supplying a sample gas to the separation column (16), the sample gas supplier (6) being attached to the main body (2), and being fluidly connected to an inlet of the separation column (16), a detector (8) for detecting components separated in the separation column (16), the detector (8) being attached to the main body (2) and being fluidly connected to an outlet of the separation column (16), an interface part (10) adjusting a temperature of pipes (22; 24) connected to the inlet and the outlet of the separation column (16) in the internal space of the main body (2), a first fan (12) for supplying outside air of the main body (2) into the case (20) of the column cartridge (4) via the intake port (26), and a second fan (14) which is different from the first fan (12), and is for cooling an outer surface of the case (20) of the column cartridge (4) by blowing outside air if the main body (2) to an outer surface of the case (20) of the column cartridge (4).
US11940421B2
A method and an apparatus for detecting bending stiffness and a method for testing a display panel. The method for detecting bending stiffness includes: arranging an object to be tested on a reference surface to make a stationary portion and a rotating portion of the object to be tested attached to the reference surface, the stationary portion and the rotating portion being connected to each other; driving the rotating portion to bend from the reference surface toward the stationary portion, and acquiring a rotation angle between the rotating portion and the reference surface; acquiring a bending force received by the rotating portion when the rotating portion is bent from the reference surface toward the stationary portion; and determining bending stiffness of the object to be tested on the basis of the bending force and the rotation angle.
US11940412B2
A biosensor system includes an array of biosensors with a plurality of electrodes situated proximate the biosensor. A controller is configured to selectively energize the plurality of electrodes to generate a DEP force to selectively position a test sample relative to the array of biosensors.
US11940408B2
A measuring device includes: a first electrode immersed in sample water stored in a measuring tank; a second electrode immersed in the sample water; and a controller that: causes a power source to flow a current through the sample water between the first electrode and the second electrode; detects, based on a first digital signal, an interruption whereby an analog signal fluctuates by no less than a predetermined value; and calculates, based on a second digital signal, a concentration of a measurement target in the sample water. The first digital signal is acquired by sampling the analog signal with a first sampling period. The analog signal is based on the current flowing through the sample water. The second digital signal is acquired by sampling the analog signal with a second sampling period that is longer than the first sampling period.
US11940400B1
A gas sensor system includes at least one gas sensor configured to receive at least one gas to be sampled; a processor configured to implement computer executable instructions; a first output interface in communication with the processor; and a computer memory in communication with the processor. A method includes measuring a density of the at least one gas; at least one of a) heating and b) cooling the at least one gas with a first thermal input; determining a first rate at which the at least one gas changes temperature when at least one of a) heating and b) cooling the at least one gas; comparing at least one of the density and the first rate to a reference database of gases; and determining at least one of a) a category b) a lower explosive limit and c) a concentration of the at least one gas.
US11940390B2
A system, method and computer readable medium for examining a specimen, the method comprising: obtaining defects of interest (DOIs) and false alarms (FAs) from a review subset selected from a group of potential defects received from an inspection tool, each potential defect is associated with attribute values defining a location of the potential defect in an attribute space; generating a representative subset of the group, comprising potential defects selected in accordance with a distribution of the potential defects within the attribute space, and indicating the potential defects in the representative subset as FA; and training a classifier using data informative of the attribute values of the DOIs, the potential defects of the representative subset, and respective indications thereof as DOIs or FAs, wherein the trained classifier is to be applied to at least some of the potential defects to obtain an estimation of a number of expected DOIs.
US11940367B2
A device for simulating carbon dioxide storage in a deep saline aquifer, including a CO2 gas source, first and second valves, first and second pressure pumps, first, second and third pressure gauges, a water storage tank, a simulation box, a first flow meter, a gas-liquid separator, a recycling tank, a microcomputer-display assembly, a structure plate, core holders, an injection pipeline, a connection pipeline, a baffle, a piezometer, a second flow meter, a heater, a lifter and an acoustic logging tool. The CO2 gas source, the first valve, the first pressure pump and the first pressure gauge for gas injection. The water storage tank, a second pressure pump and a second pressure gauge for water injection. The second valve, the third pressure gauge, the first flow meter, the gas-liquid separator and the recycling tank form an output pipeline.
US11940365B1
The present invention is directed to a passive outdoor air sampler device with various screen types and materials for efficient collection of air particles. Screens are used as a collection surface for aerosolized particles. The air sampler is suitable for long-term use in different outdoor settings with no power requirements.
US11940355B2
A wind turbine rotor blade load emulator arrangement includes a support unit constructed to support a rotor blade during a fatigue test procedure; an exciter configured to deflect the rotor blade during a fatigue test procedure; and a stiffness augmentation assembly for mounting to the rotor blade over a mounting length, which stiffness augmentation assembly is realized to increase the stiffness of the rotor blade in the mounting length. A method of carrying out a fatigue test procedure on a wind turbine rotor blade uses such a load emulator arrangement.
US11940353B2
A test device for an automatic pressure regulating valve of an electronic braking system includes a test device composed of an air supply, a pneumatic circuit, a valve, a sensor, a signal processing unit, and a control unit. By subjecting an automatic pressure regulating valve to a bench test including a functional test, a static performance test, a dynamic performance test, an air tightness test, a leakage test, and a brake chamber braking force test, the present disclosure avoids the high risk of a field test, improves the test efficiency, and ensures the test consistency. An automatic pressure regulating valve is tested before being loaded on a vehicle, and parameters of the automatic pressure regulating valve are continuously modified through tests to improve the performance, such that the automatic pressure regulating valve can meet the real-time, fast, independent, and accurate regulation requirements of EBS of commercial vehicles.
US11940339B2
Structural health monitoring systems for building structures created by additive processes can include at least an orientation sensing subsystem, a strain sensing subsystem, and a local processor. Orientation sensors can collect data from a first set of strategic locations and strain gauges can collect data from a second set of strategic locations on a 3D-printed building component. The sensors can be embedded during or after the 3D-printing process. A simulation engine can determine the strategic locations by modeling 3D geometry and material properties and simulating results from the application of various loads to determine the likely structural failure locations of the building component. The local processor can receive sensor data, filter the data, format the data for analysis, store the data, and forward the formatted data to a remotely located processing system for analysis. Additional system components can include an environmental subsystem and tensometers to collect humidity, temperature, and material deformation data.
US11940335B2
A system and a method of detecting a temperature of a battery, which calculate a resistance value of a temperature detecting unit based on a size of a voltage applied to the temperature detecting unit connected with a battery for measuring a temperature of the battery, and detect the temperature of the battery connected with the temperature detecting unit based on the calculated resistance value.
US11940326B2
A spectroscopic analysis device includes: a film that contacts a sample subject to spectroscopic analysis; a first irradiator that irradiates a first irradiation light having transition energy to decompose attached material attached to a boundary surface of the film; and an optical waveguide that transmits the first irradiation light irradiated from the first irradiator. A first evanescent wave, based on the first irradiation light, is generated on a front surface of the optical waveguide, and is then projected on an attached region of the attached material.
US11940323B2
An electromagnetic wave module comprising a chip and a lens unit. The chip has a first face, a second face opposed to the first face, and a third face connecting the first face and the second face. The lens unit has a curved face forming a lens, a fourth face opposed to the curved face, and a recessed portion encompassed in an outer edge of the curved face on a projected plane in an optical axis of the lens. The recessed portion has a fifth face disposed at a position closer to the curved face than the fourth face, and a sixth face connecting the fifth face and the fourth face. At least a part of the sixth face of the recessed portion is in contact with at least a part of the third face of the chip.
US11940303B2
There is provided a position detection device to suppress an influence of a signal distortion due to a processing error or the like, the position detection device including: a reference position calculation unit that calculates a reference position of a moving body on the basis of a first signal and a second signal, the first signal being detected from a first track provided on the moving body and having a scale of predetermined cycles, and the second signal being detected from a second track provided on the moving body and having a scale of cycles less than the predetermined cycles; a slit specifying unit that specifies a slit corresponding to a position of the moving body; an in-slit position calculation unit that calculates an in-slit position of the moving body in the specified slit; and a correction unit that corrects an absolute position of the moving body.
US11940301B2
Provided is a position indicator of an electromagnetic induction type including a position indicator cartridge housed in a hollow portion of a housing, in which the position indicator cartridge includes a first resonant circuit including a first coil wound around a magnetic core arranged on one end of the position indicator cartridge in an axial direction of the position indicator cartridge and a first capacitor, a second coil that is independent of the position indicator cartridge provided outside of the position indicator cartridge, at a position where the second coil, in operation, is magnetically coupled to the first coil of the position indicator cartridge, and a switch turned on and off by an operation portion provided outside of the position indicator cartridge, the operation portion, in operation, receiving an operation of a user, and a closed circuit including the second coil is formed when the switch is turned on.
US11940299B2
This invention describes a magnetoresistive inertial sensor chip, comprising a substrate, a vibrating diaphragm, a magnetic field sensing magnetoresistor and at least one permanent magnet thin film. The vibrating diaphragm is located on one side surface of the substrate. The magnetic field sensing magnetoresistor and the permanent magnet thin film are set on the surface of the vibrating diaphragm displaced from the base of the substrate. A contact electrode is also arranged on the surface of the vibrating diaphragm away from the base of the substrate. The magnetic field sensing magnetoresistor is connected to the contact electrode through a lead. The substrate comprises a cavity formed through etching and either one or both of the magnetic field sensing magnetoresistors and the permanent magnet thin film are arranged in a vertical projection area of the cavity in the vibrating diaphragm portion. A magnetic field generated by the permanent magnet thin film changes in the sensing direction of the magnetic field sensing magnetoresistor of magnetoresistive inertial sensor chip, which changes the resistance valve of the magnetic field sensing magnetoresistor, thereby producing a change in an output electrical signal. This magnetoresistive inertial sensor chip uses the high-sensitivity and high-frequency response characteristics of a magnetoresistor to improve the output signal strength and frequency response, thereby facilitating the detection of small and high frequency pressure, vibration, or acceleration changes.
US11940296B2
An apparatus and a method are for securing at least one measuring device to an object. The measuring device is configured for monitoring the object and is provided with a penetrating element for perforating a sheet forming part of the object. The apparatus has a body having a housing for holding the measuring device and an assembling device for moving the measuring device with respect to the housing. The assembling device has an engagement means movable between a retracted, passive position, and an extended, active position for engaging the measuring device to urge the penetrating element of the measuring device through the sheet of the object to secure the measuring device to the object. A control device is for operating the assembling device.
US11940293B2
A system may include one or more finger devices that gather input from a user's fingers. A finger device may include one or more self-mixing interferometric proximity sensors that measure a distance to the user's finger. The proximity sensor may measure changes in distance between the proximity sensor and a flexible membrane that rests against a side portion of the user's finger. The self-mixing interferometric proximity sensor may include a laser and a photodiode. In some arrangements, a single laser driver may drive the lasers of multiple self-mixing proximity sensors using time-multiplexing. The self-mixing proximity sensor may operate according to a duty cycle. Interpolation and stitching may be used to determine the total displacement of the user's finger including both the on periods and off periods of the self-mixing proximity sensor.
US11940283B2
A method for matching a vehicle with a user including receiving a user ride request for a vehicle from a plurality of available vehicles from a user, receiving a threshold vehicle risk score preference for the user, receiving a user risk score for the user, receiving a threshold user risk score preference for the plurality of available vehicles, identifying a subset of the plurality of available vehicles having a vehicle risk score at or below the threshold vehicle risk score preference of the user and a threshold user risk score preference at or above the user risk score of the user, and presenting the user with ride options for selecting one of the subset of the plurality of available vehicles of the subset of available vehicles for the user ride request.
US11940278B2
Systems and methods for indicating a navigable area that is reachable by a watercraft with a current amount of energy is provided. The system comprises a display, a processor and a memory, including a computer code configured to, when executed by the processor, cause the system to receive position data indicating a current geographic location of a watercraft; receive tidal data for the current geographic location of the watercraft; determine, based on energy remaining data, an estimated available travel distance for operating a motor of the watercraft before the watercraft runs out of energy; and generate an overlay for a chart. The overlay comprises a boundary area corresponding to the estimated available travel distance and the effect of the tide on the watercraft. The computer code further presents the overlay on the chart to visually indicate travel options from the current geographic location.
US11940275B2
A vibrator device includes a vibrator element, and a support substrate configured to support the vibrator element. The vibrator element includes a drive arm provided with a drive signal electrode and a drive constant-potential electrode, and a detection arm provided with a detection signal electrode and a detection constant-potential electrode. The support substrate includes a base, and a drive signal interconnection electrically coupled to the drive signal electrode, a drive constant-potential interconnection electrically coupled to the drive constant-potential electrode, and a detection signal interconnection electrically coupled to the detection signal electrode all provided to the base, and the drive arm includes a first surface located at the support substrate side, and a second surface located at an opposite side to the first surface. Further, the drive constant-potential electrode is disposed on the first surface, and the drive signal electrode is disposed on the second surface.
US11940273B2
A method (100) and system (500) for determining a floe size distribution (350), (516) for a plurality of floes within a geographical area (204), comprising determining a chord length distribution (512) for the geographical area (204), the chord length distribution (512) comprising a plurality of measured floe chord lengths, and determining the floe size distribution (350, 516) over the geographical area (204) based on the chord length distribution (512), the floe size distribution (350, 516) comprising a plurality of floe diameters (402).
US11940261B2
A bulkhead for transmitting detonation signals. The bulkhead is designed for use with a perforating gun assembly. The bulkhead comprises an elongated tubular body having a first end, a second end opposite the first end, and a bore extending from the first end to the second end. The bulkhead also includes a signal pin residing within the bore of the bulkhead. The signal pin also has a first end, and a second end opposite the first end. An electrically conductive wire is connected to the second end of the signal pin at the second end of the bulkhead. The bulkhead also comprises an end piece extending from the second end of the bulkhead. The end piece closely holds the conductive wire in place. Preferably, the end piece is over-molded to securely hold the detonator wire.
US11940247B2
Automated systems and methods for collecting environmental data along a ballistic trajectory are disclosed. The systems and methods may comprise automatically estimating the ballistic trajectory of a projectile. The systems and methods may comprise automatically converting the ballistic trajectory into a ballistic flight path comprising a plurality of coordinates. The systems and methods may comprise electronically communicating the ballistic flight path to a guidance system of an Unmanned Aerial Vehicle (UAV). The guidance system may be configured to cause the UAV to navigate along the ballistic flight path. The systems and methods may comprise automatically collecting environmental data along the ballistic flight path.
US11940241B2
A toy launcher with a drum magazine assembly that has a rotatable drum portion mounted for rotation, with a rear plate and a central support with an opening for a support axle. A ring of projectile holders is connected to the rear plate, with each projectile holder holding at least two projectiles arranged in a generally radially stacked configuration. Generally radially extending walls are located between adjacent projectile holders. Each of the projectile holders includes a slot on a radially inner side into which a projectile biasing arm extends at a projectile launch position. A pusher is located in the housing adjacent to the projectile launch position. Drive wheels are positioned in front of the drum magazine assembly at the projectile launch position. The drive wheels are motorized so that they rotate to propel a projectile pushed from the drum between the drive wheels for launching the projectile.
US11940240B2
A customizable firearm system includes a chassis. A barrel assembly is disposed in the chassis. The barrel assembly including a trunnion and a barrel nut assembly. The barrel nut assembly includes an outer barrel nut sleeve and an inner barrel nut sleeve receiving a barrel. The barrel nut assembly is removably disposed in the trunnion. A bolt carrier assembly is disposed in the chassis. The bolt carrier assembly includes a backplate assembly and a pair of guide rods. Each of the guide rods have a first end disposed in the backplate assembly, and a second end disposed in the trunnion. A bolt carrier slidably disposed on the guide rod.
US11940238B2
Provided herein are bolt carriers, firearms, and related methods, devices, and assemblies. A bolt carrier for a firearm of an example embodiment includes a cam slot configured to receive a cam pin of a bolt, the cam slot defining a cam path along which the cam pin is configured to travel, the cam path comprising a locked dwell, an unlocked dwell, and a transition section disposed between the locked dwell and the unlocked dwell, wherein the locked dwell defines a portion parallel to a first axis of the bolt carrier that is greater than 0.070 inches long.
US11940237B2
Disclosed is an automated gun barrel cleaning system (100) and a method thereof for straight hollow cylindrical objects, preferably gun barrels. The system (100) enables scrubbing, mopping, lubrication and wiping of the gun barrel without the need to remove the cleaning device out of the gun barrel during cleaning and to replace the brush or mopping/wiping cloth. The method of cleaning provides a time-stamped cleaning data to monitor the condition of the gun barrel and to estimate quality and effective service life of the gun barrel. The system (100) comprises of a cleaning device 102 connected to a main controller unit 106 wherein the cleaning device 102 includes drive wheel assembly 210, a driven wheel assembly 240, a spray nozzle assembly 260, a vision system 270 and a cleaning assembly 220 providing controlled scrubbing, mopping and wiping functions with controlled supply of pressurized cleaning agent and lubricant oil.
US11940231B2
A heat dissipation device includes a heat absorbing member being provided with a first accommodating chamber for accommodating a working medium and a mounting hole in communication with the first accommodating chamber; and a valve installed in the mounting hole. The valve is adjustable between a first state and a second state to change the first accommodating chamber between a closed state and an open state. When the first accommodating chamber is in the open state, the first accommodating chamber is in fluid communication with outside so that the working medium can be injected into or discharged from the first accommodating chamber, so as to adjust the amount of the working medium in the first accommodating chamber. Thus, the heat dissipation device is applicable to various applications with different heat dissipating requirements.
US11940222B2
A heat sink includes a plurality of extrusions each including a base and a fin, the plurality of extrusions being aligned in a width direction orthogonal to an extrusion direction and joined to each other. The plurality of extrusions include a first extrusion including a plurality of fins, the first extrusion including, in the base, a through-hole in which a heat pipe is mountable, the through-hole extending in the extrusion direction.
US11940219B2
The present disclosure relates to a heat exchanger. The heat exchanger includes: a plurality of tube panels including a tube elongated in one direction; a pair of header modules coupled to both ends of the plurality of tube panels; and a pair of header cases having an open side, providing a space therein, and having the header module inserted in the space such that the tube panels communicate with the spaces, in which the header modules is composed of a plurality of header blocks stacked and coupled to each other, and an insertion hole in which the tube panel is inserted is formed at each of the plurality of header blocks. Accordingly, it is possible to increase the efficiency of manufacturing a heat exchanger, manufacture a heat exchanger flexibly in a custom-made type in accordance with the size of a product having the heat exchanger, reduce tolerance due to brazing, and improve stability of a product.
US11940217B2
A method for moulding a sheet into a component of complex shape having areas with different mechanical properties, particularly a motor-vehicle component, includes a first heating step of the sheet carried out by a kiln, prior to forming the component. The kiln has a main body with a roller shape, having a plurality of sectors extending along a radial direction with respect to a longitudinal axis of the roller body. The sectors are configured to each receive a sheet, so that the main body with a roller shape is arranged to simultaneously carry a plurality of sheets. The kiln includes a plurality of heating elements incorporated in the roller-shaped main body, so as to heat the sheets in contact with the roller body. The kiln includes at least one electronically-controlled drive motor, arranged to rotate the roller-shaped main body around the longitudinal axis of the kiln, so as to vary the position of the sectors with respect to the inlet and outlet ports. An additional heating step follows extraction of the sheets from the kiln, wherein the sheets are locally heated only at one area, so as to obtain sheets with areas heated to different temperatures.
US11940216B1
Disclosed is a high-temperature flue gas recovery apparatus for a melting furnace, which relates to copper production, including a preheating chamber and a feeding mechanism, a lower end of the preheating chamber being in communication with a feeding port of the melting furnace, the feeding mechanism being disposed above the preheating chamber to deliver feedstock into the preheating chamber, a plurality of layers of buffer mechanisms layered in an upper-lower manner being provided in the preheating chamber, each layer of the buffer mechanism including a buffer element and a drive element, the drive element driving the corresponding buffer element to move such that the feedstock on the buffer element of an upper-layer buffer mechanism falls onto the buffer element of a lower-layer buffer mechanism, a gap allowing a gas to pass through being provided between the buffer mechanisms and an inner wall of the preheating chamber. The solution may recover the high-temperature flue gas produced by the melting furnace to preheat the feedstock, thereby enhancing the energy utilization ratio during the production process; moreover, with the plurality of buffer mechanisms, the solution may charge the feedstock into the melting furnace in small quantity per time and in multiple times, facilitating accurate control of the feeding rate and amount of the feedstock.
US11940213B2
The invention relates to a drying system (T) according to FIG. 1 for drying goods to be dried (LTG), comprising—a drying tunnel (TT), —a line (LAG) for exhaust gas (AG) containing (VOC) out of the drying tunnel (TT), —a controlled fan (GBL) for further transporting the exhaust gas (AG) to a heat exchanger (WT), —a heat exchanger (WT) for heating the exhaust gas (AG) using the clean gas (RG), —an exhaust gas line (LAG) downstream of the heat exchanger (WT) for further transporting the exhaust gas (AGWT) to a burner (BR) in a combustion chamber (BK) of a thermal post-combustion system (TNV), —a cold bypass (BP) which bypasses the heat exchanger (WT) and which can be regulated using an electronically controlled controller (R), —a fuel line (LEG) for a fuel (EG) to the burner (BER), —a clean gas line (LRG) for transporting the clean gas (RG) out of the combustion chamber (BK) to the heat exchanger (WT) in order to cool the exhaust gas (AG), —a clean gas line (LRG) for conducting the clean gas (RG) from the heat exchanger (WT) to the heat consumers (WA), —a heater (HZTT) for heating the drying zone (TT) by means of the heat consumers (WA), and —a clean gas line (LRG) for conducting the clean gas (RGD) to a stack (K). The invention also relates to a drying method and a method for a thermodynamic regulation (TDR).
US11940205B2
An insulating structure for an appliance includes a trim breaker, a first panel, a second panel, and an adhesive. The trim breaker defines a first groove and a second groove. The first panel is disposed within the first groove and is coupled to the trim breaker. The second panel is disposed within the second groove and is coupled to the trim breaker. The adhesive is disposed within the first and second grooves and is coupled to the first and second panels.
US11940202B2
An appliance includes a cabinet, defining a food storage chamber, and a door. The appliance includes a hinge system coupling the door to the cabinet. The hinge system includes a first hinge arm fixed to the door, a second hinge arm pivotably joined with the first hinge arm, a carrier fixed to the cabinet, the second hinge arm releasably received in the carrier, and a tether cable extending between a first end and a second end. The first end of the tether cable fixed to the second hinge arm, the second end of the tether cable removably attached to a surface inside the food storage chamber. The tether cable configured such that the door may be detachable from the cabinet when the second end of the tether cable becomes detached from the surface inside the food storage chamber.
US11940200B2
The present invention provides a control method of a refrigerator, comprising: a first defrosting step of defrosting an evaporator and terminating the defrosting when the evaporator reaches a first temperature; a step of detecting pressure difference by means of a differential pressure sensor for measuring pressure difference between a first thru-hole, disposed between the evaporator and an inlet through which air flows in from a storage compartment, and a second thru-hole disposed between the evaporator and an outlet through which the air is discharged into the storage compartment; and a second defrosting step of additionally defrosting the evaporator if the measured pressure difference is greater than a configured pressure.
US11940199B2
A refrigerator including a housing mounted at a rear surface of a door to define a storage space of food, a basket disposed inside the housing, a duct extending to the housing from one side of an evaporator to supply cold air generated by the evaporator into the storage space of the housing, and a fan assembly coupled to the duct to allow the cold air to be forcibly supplied.
US11940192B2
An air conditioning device has: a refrigerant circuit that includes a compressor, a switching valve, a cascade heat exchanger, an expansion valve and an outdoor heat exchanger connected to one another by a first pipe through which a refrigerant flows, and that performs a defrosting operation in which the refrigerant discharged from the compressor is introduced into the outdoor heat exchanger; a heat-transfer medium circuit that includes a pump, the cascade heat exchanger, and the indoor heat exchanger connected to one another by a second pipe through which a heat-transfer medium flows; and a control device that controls the compressor and the pump. When an amount of heat storage of the heat-transfer medium is less than a threshold, the control device reduces the heating capability of the indoor heat exchanger when the air conditioning device transitions from a heating operation to the defrosting operation.
US11940187B2
A water treatment system of coupling a heat pump with multi-effect evaporation that comprises a lithium bromide absorption-type heat pump circulation system, a multi-effect evaporation circulation system and a compression-type heat pump circulation system is provided. The vapor in a tail-end evaporator of the multi-effect evaporation circulation system is introduced into a generator in the absorption-type heat pump to release heat and condense. A dilute solution in an absorber of the absorption-type heat pump is introduced into a first-effect evaporator to be evaporated by a treated water, and a condensation heat of the vapor generated by the generator of the absorption-type heat pump is recovered by an evaporator of a compressor heat pump, and another air source evaporator absorbs heat from ambient air to supply heat for the generator by a heat pump condenser.
US11940186B2
A refrigeration system includes a refrigeration circuit and a coolant circuit separate from the refrigeration circuit. The refrigerant circuit includes a gas cooler/condenser, a receiver, and an evaporator. The coolant circuit includes a heat exchanger configured to transfer heat from a refrigerant circulating within the refrigeration circuit into a coolant circulating within the coolant circuit, a heat sink configured to remove heat from the coolant circulating within the coolant circuit, and a magnetocaloric conditioning unit configured to transfer heat from the coolant within a first fluid conduit of the coolant circuit into the coolant within a second fluid conduit of the coolant circuit. The first fluid conduit connects an outlet of the heat exchanger to an inlet of the heat sink, whereas the second fluid conduit connects an outlet of the heat sink to an inlet of the heat exchanger.
US11940177B2
An air treatment apparatus (10), such as a dehumidifier or latent cooling system, has a desiccant wheel (12) having a plurality of similar internal structures (14), a shroud (16), at least a first fan (18, 20), a motor (30), an axle (32), slip rings (34), and sliding contacts (36). The similar internal structures are coated with a desiccant, and may be shaped as blades, cylinders, boxes, teeth, or corrugations. The shroud divides the wheel into an active area where the desiccant removes moisture to provide treated air (22), and a regeneration area where the desiccant is heated to release the adsorbed moisture from the air (28). Switches, such as magnetic switches, apply electrical power to heaters in the similar internal structures as they rotate into the regeneration area thereby heating and drying the desiccant.
US11940173B2
The present application provides a heat exchange device. The heat exchange device includes: a case, an interior of which is formed into an air-supply inflow space, an exhaust inflow space, an air-supply outflow space and an exhaust outflow space separated from each other, wherein a first extension wall is provided between the air-supply inflow space and the exhaust outflow space; and a heat exchange unit disposed in the case, and the air-supply inflow space and the air-supply outflow space communicate with each other by the heat exchange unit to form an air-supply air path, and the exhaust inflow space and the exhaust outflow space communicate with each other by the heat exchange unit to form an exhaust air path, wherein the air-supply air path and the exhaust air path exchange heat when passing through the heat exchange unit; the first extension wall is provided with a circulation air port communicating the air-supply inflow space and the exhaust outflow space, wherein the circulation air port may be selectively opened and closed. The heat exchange device may not only provide indoor air circulation but also ensure heat exchange efficiency.
US11940172B2
A plenum slot diffuser includes a plenum box having five walls formed by joining edges of a C-shaped bracket having first, second, and third walls of the five walls with additional edges of an L-shaped bracket having fourth and fifth walls of the fives walls. An air input opening of the plenum box is disposed in one of the five walls and is configured to be coupled to a duct, and an open end of the plenum box defines an air output opening. The plenum slot diffuser includes at least one blade and a blade holding rod comprising a neck, wherein the neck faces away from the air output opening of the plenum box.
US11940164B2
The purpose of the present invention is to provide a vehicle air conditioning system and a control method of the vehicle air conditioning system which enable detecting leaks of flammable refrigerant without requiring a separate sensor. This vehicle air conditioning system is provided with: a refrigeration cycle for cooling (23); a heat pump cycle for heating (33); a refrigerant that is very flammable, has an explosive range near room temperature, and circulates in the refrigeration cycle for cooling (23) and the heat pump cycle for heating (33); an outside temperature sensor (44) which detects the outside temperature; a pressure sensor (49) which detects the refrigerant pressure; and a control device which calculates the refrigerant density, which is the density of refrigerant, on the basis of the outside temperature and the pressure, and determines whether or not the refrigerant density has fallen below a prescribed threshold value which is based on the amount of sealed refrigerant, the total volume in the refrigeration cycle for cooling (23) and in the heat pump cycle for heating (33), the volume of the vehicle cabin, the standard density of the atmosphere, and the explosive limit of the refrigerant.
US11940163B1
A portable temperature-controlled device includes a housing and a controllable temperature element having a first surface and a second surface, wherein the first surface opposes the second surface. Inside the housing, a heat sink is disposed and in contact with the first surface of the controllable temperature element, and a fan is disposed adjacent the heat sink inside the housing and configured to direct heat away from the heat sink. The portable temperature-controlled device further includes a heat spreader in contact with the controllable temperature element for thermal energy transfer. The heat sink and the fan are supported on a support member inside the housing.
US11940159B2
A temperature probe for a cooktop appliance includes a probe body and a temperature sensor extending from the probe body. The temperature probe also includes a first arm and a second arm configured to mount on a cooking utensil. The temperature probe further comprises a controller configured to communicate with a controller of the cooktop appliance and to transmit a signal to the controller of the cooktop appliance corresponding to a size of the cooking utensil.
US11940145B1
A lighting device has a rectangular cubic shape and includes “leaves” which may be pivoted between closed and opened positions. Three separate options for illumination devices are included which are all unique and differ from one another. Illumination means is operated by a switch that closes a circuit activating illumination when a leaf is opened and opening the circuit thereby stopping illumination when a leaf is closed. The illumination means for each leaf consists of one or more LEDs. Known technology allowing the LEDs to change colors and to be dimmed or brightened may suitably be employed. If desired, artificial intelligence (AI) technology may be incorporated into the lighting device. For example, the device can be operated using voice prompts to dim or brighten LEDs, illuminate them or stop illumination and change colors. A dedicated phone App can be utilized in controlling the various modes of operation of the invention.
US11940140B2
Disclosed herein is a light transmissive fiber integrated knit textile for use on consumer electronic products. The knit textile is depicted to be constructed with light transmissive fibers integration through a weave-in/inlay knit technique with a flat-bed knitting construction. The light transmissive knitted textile is also tethered to a portable electronic device, allowing for the light transmitting fibers knitted into the fabric to define a lighting display on said fabric.
US11940135B2
Methods and apparatus for implementing a control apparatus for a light fixture for externally controlling the current to the LED light emitter of a landscape LED light fixture. In an exemplary embodiment a control apparatus for controlling current to an LED light source in a landscape lighting device includes an LED driver, a user control with a control setting indicator, and a driver housing including setting indicators.
US11940131B2
An adjustable utility lighting system that includes multiple flexible supports for different lights to effectively illuminate multiple areas of the engine compartment simultaneously. The adjustable utility lighting system includes a base member that includes a plurality of adjustable support legs for securing the base member in position when the ferromagnetic surface is not available for the base member to mount to. There are also gooseneck supports that are permanently attached to the base member by a coupling that couples a first end of each of the gooseneck supports to the top surface of the base member. There is also a rechargeable battery that is a 18650 rechargeable battery that is easy to replace.
US11940118B2
A lighting device for a vehicle, having a plurality of light sources, which are arranged in an array, in particular in line-by-line and column-by-column fashion, and can be operated independently of each other at least in part, wherein the light sources emit light during operation; an exit face through which the light emanating from the light sources passes; and a plurality of extensive boundary elements, which extend at least partly in a region between the light sources and the exit face and serve to separate the light emanating from different light sources, wherein at least some, preferably all, of the extensive boundary elements have a reflector which at least partly reflects the light emanating from one of the light sources in the direction of the exit face.
US11940116B2
To improve the sense of connection between a fixed-side lamp unit and a movable-side lamp unit. A vehicle lamp includes; a fixed-side unit, and a movable-side unit, the fixed-side unit has: a first light source; a first light guide body; and a first outer lens having a first front surface part, and a first leg part, the movable-side unit has: a second light source; and a second light guide body; and a second outer lens having a second front surface part, and a second leg part, the second leg part has a light control surface, and the light control surface performs control such that light emitted from at least one of the first light source and the second light source and incident on the light control surface passes through inside of the second leg part and is emitted from a front surface side of the second leg part.
US11940106B2
A low-profile modular lighting device with flexible installation mounting options includes a lower housing, a circuit board supported by the lower housing and having electronic devices mounted thereto, and a plurality of upper housings each configured to releasably couple to the lower housing. The electronic devices of the circuit board extend within the space defined by an interior surface and upper edge of the lower housing and within the space defined by an interior surface and lower edge of each of the plurality of upper housings when coupled to the lower housing. Each of the plurality of upper housings provide a different mounting configuration for the modular lighting device. The modular lighting device may include one or more of a motion sensor, a light sensor, and a wireless transceiver for communication with a wireless lighting system.
US11940103B1
Apparatus and system for producing light using LED lighting with output within a predetermined desired color temperature range for commercial lighting uses which may be bicolor or may be multicolored. A preferred embodiment includes a first and second group of LEDs arranged in an alternating matrix configuration, each group of LEDs configured to produce light in a predetermined color temperature range. In a preferred embodiment, an LED light system includes a tubular LED lamp having substantially the same size and dimensions as a traditional fluorescent lamp tube and a control box for controlling power input and power gain to the first, second, or both groups of LEDs.
US11940085B2
A cover structure of an upper unit in which a power source of an outboard motor is provided, the cover structure includes a main body cover including a pair of divided covers connected to each otter, the pair of the divided covers being configured to be divided into each other in a left-right direction with respect to a traveling direction of a boat, an attachable and detachable cover that is attachable to and detachable from a part of an outer surface of at least one of the pair of divided covers and that includes a light transmitting portion in at least a part of the attachable and detachable cover, the light transmitting portion configured to transmit light, and a light emitter that is provided at a mounting position of the attachable and detachable cover and that includes a light source.
US11940084B2
Thermal insulating sleeve liner for fluid flow device and fluid flow device incorporating such liner
A monolithic metal thermal insulating sleeve liner for fluid flow devices such as valves and piping used in severe industrial applications is additively manufactured (e.g., by 3D printing) to fit the bore of a protected fluid flow device. Tessellated support structures obliquely extending between inside surfaces of inner and outer shells provide increased resistance to thermal conduction while also providing increased strength against compression forces. Example support structures include an array of four obliquely oriented elongated members mutually intersecting mid-way between the inside surfaces of inner and outer cylindrical shells. If internal interstices are sealed they can be vacuumed or pressurized to enhance thermal insulating properties. A pressure equalizing aperture can be provided on or through the sleeve if needed in some applications.
US11940081B2
Disclosed are a cabin pipeline using a super thermal insulation material and a preparation method thereof, comprising an electrically conductive inner pipe, an anti-corrosion coating coated on the electrically conductive inner pipe, a thermal insulation layer formed by a super thermal insulation material wound on the anti-corrosion coating, and a resin sealing layer coated on an outside of the thermal insulation layer. The electrically conductive inner pipe has excellent corrosion resistance to liquefied natural gas in the pipeline; the protective layer formed by the anti-corrosion coating and the resin sealing layer can prevent the electrically conductive inner pipe from being directly exposed to the environment due to long-term seawater infiltration or accidental damage of the outer layer, avoid electrochemical corrosion and further improve the corrosion resistance.
US11940067B2
A system for remotely opening and closing a process equipment bolt flange joint may include a hydraulic cylinder actuator assembly for attaching to the flanges of a bolt flange joint to open and close the joint by operation of a remote hydraulic pump. More than one actuator assembly may be evenly spaced around the flange joint, to ensure even distribution of force around the joint. The system may have an accumulator for receiving hydraulic fluid expelled from the hydraulic cylinder during extension and to force hydraulic fluid back into the cylinder to close the flange joint upon pressure release at the pump. A drop trigger may be used to release hydraulic pressure at the pump for emergencies. The system may include a video camera for viewing the joint on a display. The components may be stored and transported on a mobile cart. A method of use is also disclosed.
US11940065B2
A connector for use in association with a lighting assembly that allows for components to be quickly assembled in an easily aligned configuration, including: a body having a first end, a second end, an interior sidewall, and an exterior sidewall; wherein the first end of the body and the second end of the body define a length therebetween; wherein a portion of the exterior sidewall of the body is threaded proximate the first end; wherein a portion of the exterior sidewall of the body is non-threaded proximate the second end; a first aperture associated with the first end of the body; a second aperture associated with the second end of the body; and a conduit positioned between the first aperture and the second aperture, wherein the conduit is adapted for containing an electrical cord from an associated lighting assembly.
US11940056B2
A vehicle driveline component that includes a tubular body, a relief valve, a vent cover and a pin. The tubular body has a first and second axial ends and defines an interior circumferential surface. The relief valve is mounted in the tubular body between the first and second axial ends. The vent cover is mounted to the tubular body and covers the second axial end. The pin is mounted to the tubular body at a location between the first axial end and the relief valve. The pin extends through the interior circumferential surface into a hollow interior of the tubular body.
US11940055B2
In general terms, the present invention relates to a safety valve or a pressure relief valve (PRV) that is developed to be used in combination boilers and similar appliances and utilized for the purpose of controlling or limiting system pressure. Relief valves are generally used as safety devices in systems where fluid pressure is important, and they reduce the system pressure either by discharging fluid from the system or simply by interrupting the fluid conveyance in case of an emergency when there is an increase in pressure. The present invention relates to a pressure relief valve, the rear cover of which is attached to the body by means of a clawed structure and manufactured from entirely recyclable thermoplastic material.
US11940051B2
The invention relates to a mechanical seal arrangement comprising a first slide ring seal (2) having a rotating slide ring (21) and a stationary slide ring (22) defining a sealing gap (23) therebetween, a shaft sleeve (4), a driver (5) which connects the shaft sleeve (4) to the rotating slide ring (21) and which is arranged to transmit rotation of the shaft sleeve (4) to the rotating slide ring (21) a connecting arrangement (6) for connecting the shaft sleeve (4) to the driver (5), the connecting arrangement (6) comprising at least two rotary locks (60) and at least two recesses (40) in the shaft sleeve (4), wherein each of the rotary locks (60) has a bearing portion (61) and a locking portion (62), wherein the locking portion (62) laterally projects beyond the bearing portion (61), and wherein a rotational axis (Y-Y) of each rotary lock (60) is parallel to a central axis (X-X) of the shaft sleeve (4).
US11940050B2
A seal for an axle shaft assembly which may be found in an automotive transmission or drive axle, is provided. The seal may accommodate significant axle deflection, while retaining a fluid-tight seal between multiple sealing surfaces. The seal may include dynamic flanges configured to seal against surfaces which are angled or orthogonal with respect to one another. The seal may also include one or more holes extending from an outer surface to an inner surface of the seal, such that a body of the seal forms a conduit which allows fluid, such as lubricating fluid, to flow through the seal.
US11940047B2
To provide a simple-structured chain guide assembly frame capable of reliably maintaining a correct positional relationship between a driven sprocket and a sprocket holding portion without the possibility of driven sprocket detachment. The chain guide assembly frame includes a main body having a fixed-guide-side sprocket holding portion and a pivoting-guide-side sprocket holding portion. The fixed-guide-side sprocket holding portion includes a first fixed-guide-side support portion that supports a driven sprocket at a first contact point, and a second fixed-guide-side support portion that supports the driven sprocket at a second contact point located more outside than the first contact point. When the driven sprocket is in an erected state in which the driven sprocket is supported at the first contact point and second contact point, the vector of gravity acting on the gravity center of the driven sprocket points between the first contact point and second contact point.
US11940043B2
A baffle plate (4) including a body portion (5), a cover portion (8, 9) and a seal member (88, 98), a final gear (25) and a driven sprocket (DS) disposed in an accommodating chamber (Sa, Sb) of the baffle plate (4), an oil pump (OP) serving as a source of oil (OL) for lubrication, and an oil pan (16) are provided. At least one of the body portion (5), the cover portions (8, 9) and the seal members (88, 98) includes a material that shrinks as the temperature of the oil (OL) decreases. The baffle plate (4) is dimensioned such that a gap (CL1, CL2) is sealed by the seal member (88, 89) when the temperature of the oil (OL) is equal to or higher than a predetermined oil temperature and an aperture (CL′) is formed when the temperature of the oil (OL) is less than the predetermined oil temperature. The gap (CL1, CL2) is the gap between an inner circumference of an outer wall portion (62, 72) of the body portion (5) and each of a base portion (80) of the cover portion (8) and a base (90) portion of the cover portion (9).
US11940033B2
A dirt shield for shock absorbers having a piston assembly and a cylinder member with a metal dirt shield cap connected to a rod of the piston assembly. A plastic dirt shield bracket is adapted to be fixed to the metal dirt shield cap and includes a first portion and a second portion hingedly connected to one another. A dirt shield tube is connected to the plastic dirt shield bracket.
US11940027B2
An aircraft brake temperature control system (BTCS) 100 for controlling a temperature of a brake 220 of a landing gear 201 of the aircraft 200. The BTCS 100 includes a controller 110 configured to cause at least one fluid moving device 230, 231, 232 to drive a flow of fluid onto the brake 220, selectively in one of a plurality of modes, to control the temperature of the brake 220. The BTCS 100 may be incorporated into an aircraft system 1000 with at least one fluid moving device 230, 231, 232, wherein the aircraft system is on an aircraft 200.
US11940009B2
A bearing seal including an anchoring portion fixed on an inner ring of the bearing, and a sealing portion capable of forming a sealing fit with an outer ring of the bearing, the seal providing rigid slinger of substantially circular shape, the slinger having a root portion formed at a position corresponding to the anchoring portion for stabilization and support, and a radial portion formed in the section corresponding to the area between the anchoring portion and the sealing portion for radial support, wherein the radial portion is formed with at least one slot with the opening direction facing the radial periphery.
US11940005B2
A radial foil bearing includes a bearing housing which has an insertion hole therein, a top foil which is disposed inside the insertion hole, and a foil structure which is interposed between the top foil and the bearing housing, the foil structure has a folded protruding portion that is bent outward in a radial direction of the insertion hole and is bent back inward in the radial direction, and the folded protruding portion is fitted to a fitting groove formed in an end surface of the bearing housing in an axial direction, the axial direction being a direction in which the insertion hole extends.
US11940002B2
The present disclosure relates to a two-part adjustable potted insert to be received within an insert hole of a honeycomb panel for fastening a threaded fastener thereon. The insert comprises an outer structural member which is configured to be received within the insert hole, and an inner structural member in a releasable engagement with the outer structural member. The outer structural member comprises an external main body which defines an external surface configured to resist pull-out and torque-out to retain the outer structural member in the honeycomb panel when inserted in the insert hole, a threaded opening within the external main body which defines a bottom surface, and a locking recess formed within the bottom surface.
US11939996B2
A locking system includes a locking element which is movable between a first, locking position and a second unlocking position and an unlocking actuator for moving the locking element (from the first position to the second position over an unlocking stroke length (Su). The system further comprises a control unit configured to command the unlocking actuator to move the locking element from the first position to a third position over an anti-icing stroke length (Sa) which is shorter than the unlocking stroke length (Su).
US11939992B1
A system for mounting a fan to a ceiling includes a connector adapted to attach to the ceiling. The connector includes at least one guide. An adaptor is adapted to attach the fan to the connector, and includes at least one rail adapted for being received within the at least one guide. A safety bracket is also provided, which is adapted to attach to the ceiling separate from the connector and connect to a safety cable without using a tool. A motor support is also provided with a cavity adapted to receive the power supply, and at least one retainer serves to retain the power supply within the cavity. A quick-connecting escutcheon is also adapted to rotatably connect to the connector.
US11939989B2
A ceiling fan or similar air-moving device can include a motor for rotating one or more blades to drive a volume of air about a space. A connector can be used to connect the blade to a blade iron to mount the blade to the motor. The connector can include a set of receptacles configured to insert into openings on the blade, with the set of receptacles connected by a set of arms. A set of mount posts on the blade iron can seat within the receptacles to mount the blade to the blade iron.
US11939985B2
A control circuit including a motor drive unit and a processing control unit is provided. The motor drive unit includes a drive current for a motor according to a modulation signal, and the motor is powered by a storage battery. The processing control unit obtains an actual speed of the motor, calculate the modulation signal by comparing the actual speed and a target speed, and transmit the modulation signal to the motor drive unit. Also, the modulation signal is used to control rotation of the motor by modulating the drive current, so that the actual speed tends to be equal to the target speed.
US11939980B2
An electronic unit, in particular for an electric fluid pump of a motor vehicle, having a functional element for holding electronics, and a heat sink arranged on the functional element, wherein the functional element and the heat sink are sealed from one another in fluid-tight fashion by means of a cured sealing compound of a liquid seal, and wherein the functional element has at least one ventilation opening, which is open in the course of a curing process for the sealing compound, and which, after the curing process, is sealed in fluid-tight fashion by means of a closure element.
US11939977B2
A scroll compressor comprising a fixed scroll (15); an orbiting scroll (16) supported in a manner allowing for orbiting motion; a discharge port through which a fluid compressed by the two scrolls (15, 16) is discharged; an end plate step portion (16E) provided on an end plate of the orbiting scroll (16) formed so that a height of the end plate is higher on a center portion side in the direction of a spiral wrap and lower on an outer end side; and a wrap step portion (15E) provided on a wall portion of the fixed scroll (15) that corresponds to the end plate step portion (16E) so that a height of the wall portion is lower on the center portion side of the spiral and higher on the outer end side; wherein the orbiting scroll (16) is treated for surface hardening and the fixed scroll (15) is not treated for surface hardening.
US11939957B2
A monitoring system for monitoring a time period of a locking state of a rotor of a wind turbine includes at least one motion sensor and at least one computing unit, wherein the computing unit is configured to receive at least one motion measurement from the at least one motion sensor and wherein the computing unit is configured to determine whether the rotor may remain in the locking state or the rotor should be unlocked based on the at least one motion measurement. A wind turbine having the monitoring system and a method for monitoring a time period of a locking state of a rotor of a wind turbine is also provided.
US11939952B2
A method of installing a wind turbine (10) at an offshore location. The wind turbine (10) includes a tower (18) and an energy generating unit (16). The tower (18) is configured to be secured to a transition piece (12, 42). Prior to shipping, the method includes electrically coupling electrical devices and/or systems (52) by cables (54) to energy generating unit (16) or wind turbine tower (18) or a test dummy therefor. The electrical devices and/or systems (52) are configured to be attached to transition piece (12, 42) once the tower (18) is installed. The method includes testing and commissioning the electrical devices and/or systems (52) while electrically coupled to the cables (54). Prior to shipping and after testing and commissioning, the method includes storing the electrical devices and/or systems (52) and attached cables (54) inside the tower (18). The cables (54) are long enough to permit the electrical devices and/or systems (52) to be attached to the transition piece (12, 42) without disconnecting the electrical devices and/or systems (52) from the cables (54).
US11939950B2
A modular blade connection structure includes a first module, a second module and a structural adhesive module. The first module is provided on an end face thereof with a bonding flange extending into the second module; a gap between the butting surfaces of the first module and the second module is injected with a structural adhesive, which is extruded and cured to form a structural adhesive module; and the thickness of the first module at the starting end of the bonding flange extends towards the inner surface to form a first reinforcement, and the structural adhesive module extends inside the second module in a direction away from the bonding flange to form a second reinforcement. The present disclosure facilitates the control the bonding quality of the double-sided overlapping of the modular blade by means of the bonding flange and the improvement of the fatigue resistance at the assembling position.
US11939948B2
Disclosed is a blade shell section of a wind turbine blade, such as wind turbine blade with a flatback section. The blade shell section extends in a longitudinal direction from a first shell section position to a second shell section position. The blade shell section comprises a first laminate layer forming the outer surface of the blade shell section and a second laminate layer forming the inner surface of the blade shell section. The blade shell section further comprising a first shell section and a corner shell section between the contour shell section and the flatback shell section.
US11939944B2
It is disclosed an electronic device to control an ignition coil of an internal combustion engine, comprising a high-voltage switch, a driving unit, a bias circuit and an integrating circuit. The high-voltage switch is connected in series with a primary winding of a coil. The driving unit is configured to control the closing and opening of the high-voltage switch. The integrating circuit is interposed between the bias circuit and a reference voltage. The integrating circuit comprises an integrating capacitor connected in series to the bias circuit and connected between the bias circuit and the reference voltage. The integrating capacitor is configured to maintain a substantially null charge during a phase of measurement of a ionization current as to measure a substantially null value of an integral of the ionization current, in the case of a misfire of the comburent-combustible mixture.
US11939935B2
A coupling system is utilized to form a multi-part rocket engine thrust compartment that maintains inner channels within walls of the thrust compartment for regenerative cooling. The coupling system includes an insert joint arranged between joint faces of a first segment and a second segment. The first segment and the second segment include inner edges that, when jointed together, form an inner wall. The joint insert is installed between the first segment and the second segment after the inner wall is formed and coupled to the first segment and the second segment. The joint faces of the first segment and the second segment include extending feature to form a flow passage along with cavities at least partially defined by the joint insert.
US11939931B2
An internal combustion engine controller comprising a memory and a processor is provided. The memory is configured to store a plurality of control maps, each control map defining a hypersurface of actuator setpoints for controlling an actuator of the internal combustion engine based on a plurality of input variables to the internal combustion engine controller. The processor comprises an engine setpoint module and a map updating module. The engine setpoint module is configured to output a control signal to each actuator based on a location on the hypersurface of the respective control map defined by the plurality of input variables. The map updating module is configured to calculate an optimised hypersurface for at least one of the control maps. The optimised hypersurface is calculated based on a real-time performance model of the internal combustion engine comprising sensor data from the internal combustion engine and the plurality of input variables. The map updating module further is configured to update the hypersurface of the control map based on the optimised hypersurface. A method of controlling an internal combustion engine is also provided.
US11939925B2
A gas turbine engine includes a core having a compressor section with a first compressor and a second compressor, a turbine section with a first turbine and a second turbine, and a primary flowpath fluidly connecting the compressor section and the turbine section. The first compressor is connected to the first turbine via a first shaft, the second compressor is connected to the second turbine via a second shaft, and a motor is connected to the first shaft such that rotational energy generated by the motor is translated to the first shaft. The gas turbine engine includes a takeoff mode of operation, a top of climb mode of operation, and at least one additional mode of operation. The gas turbine engine is undersized relative to a thrust requirement in at least one of the takeoff mode of operation and the top of climb mode of operation, and a controller is configured to control the mode of operation of the gas turbine engine.
US11939924B2
A system for modulating air flow in a gas turbine engine is provided. The system may include a seal wall comprising an opening, a seal door configured to slideably engage the seal wall, and an actuator configured to move the seal door over the opening. In various embodiments, the system may include a surface forward of the seal door. The seal door may be configured to seal a passage through the surface and the opening of the seal wall. A track may be disposed under the seal door. The track may comprise cobalt. Rollers may be coupled to the seal door with the rollers on the track. The seal door may comprise a nickel-chromium alloy. A sync ring may be coupled to the seal door. The actuator may be coupled through the sync ring to the seal door.
US11939921B2
A combustion-gas supply system and a combustion-gas supply method thereof, a device equipped with a turbine engine, and a fracturing system are provided. The combustion-gas supply system includes a main pipeline and a multi-functional pipeline; the main pipeline includes a first sub-pipeline and a second sub-pipeline; the first sub-pipeline includes a first gas intake pipe, a first gas supply valve and a first gas outlet pipe arranged in sequence; the second sub-pipeline includes a combustion-gas supply valve and a gas supply pipe, the first gas outlet pipe is connected with the combustion-gas supply valve, the gas supply pipe is configured to be connected with a turbine engine, the multi-functional pipeline includes a second gas intake pipe, a second gas supply valve and a second gas outlet pipe arranged in sequence, and the second gas outlet pipe is communicated with the first gas outlet pipe.
US11939914B2
There is described a method of operating a multi-engine system of an helicopter. The multi-engine system has a first turboshaft engine having a first shaft, a second turboshaft engine having a second shaft, a gearbox having a clutch system, and a range of rotation speeds defined as a placarded zone. The method generally has rotating the first shaft at a flight rotation speed when clutched and rotating the second shaft at a first idle rotation speed when unclutched, the first idle rotation speed above the placarded zone; decreasing a rotation speed of the first shaft from the flight rotation speed to a given rotation speed within the placarded zone; decreasing a rotation speed of the second shaft to the given rotation speed; clutching the second shaft; and decreasing the rotation speeds of the first and second shafts to a second idle rotation speed below the placarded zone.
US11939907B2
An ECM executes a catalyst early activation control at the cold start of an engine such that the activation of a catalyzer is promoted by opening a WGV. Further, the ECM performs a diagnosis process of diagnosing whether or not the WGV is stuck closed, based on the amplitude of the output fluctuation in an air-fuel-ratio sensor during execution of the catalyst early activation control.
US11939902B2
An apparatus of purifying exhaust gas of a hybrid vehicle includes an electric supercharger disposed on an air intake line, a post-treatment unit disposed on an exhaust gas line and including an electrically-heated catalyst, an exhaust gas recirculation unit including an exhaust gas recirculation cooler disposed on a recirculation line connecting the post-treatment unit and the intake line and an exhaust gas recirculation valve disposed on the recirculation line, a three-way valve disposed at a position at which the recirculation line diverges into a front end portion and a rear end portion of the intake line, and a controller electrically connected to the three-way valve and configured for controlling the three-way valve connecting the intake line and the recirculation line at the front end portion of the electric supercharger to be selectively opened or closed.
US11939901B1
An oxidizing reactor apparatus having a heat exchange reactor having an input port, an entry channel in fluid communication with the input port, an exit channel in fluid communication with the entry channel via a plurality of pores and an output port in fluid communication with the exit channel, wherein the exit channel is in thermal communication with the entry channel, an engine in fluid communication with the heat exchange reactor and a heater engaged with the heat exchange reactor to initiate and maintain the oxidation of fuel within the heat exchange reactor. The disclosed heat exchange reactor may be configured to receive engine exhaust from the engine and oxidize fuel within the engine exhaust prior to expelling the engine exhaust. The heat exchange reactor may be further configured to utilize heat released by the oxidation of un-combusted fuel to increase the temperature of the engine exhaust leaving the engine.
US11939896B2
A blowby gas return apparatus is provided that achieves inhibition of condensation of water vapor in blowby gas in branched return passages. A blowby gas return apparatus that returns blowby gas generated in an engine having a plurality of cylinders to an intake system of the engine includes a distribution portion inside a head cover of the engine, and distributes the blowby gas to intake paths of the cylinders. The distribution portion includes an introduction portion through which the blowby gas is introduced and a plurality of branch passages communicating with the introduction portion, plurality of branch passages branching from the introduction portion to communicate with the intake paths.
US11939893B2
A cylinder crankcase for an internal combustion engine includes at least one riser duct. The cylinder crankcase comprises at least one additional riser duct, which is configured to exchange oil between the main oil gallery and the cylinder head. The cylinder crankcase also comprises a connecting duct, via which the at least one riser duct and the at least one additional riser duct are connected in an oil-conducting fashion.
US11939890B2
A continuous variable valve duration apparatus includes: a camshaft, a front cam unit and a rear cam unit of which the phase relative to the camshaft can be varied, a front inner wheel and a rear inner wheel, a front guide bracket and a rear guide bracket, a front wheel housing and a rear wheel housing, a front control shaft, a rear control shaft, a phase controller selectively changing the relative phase of the front control shaft and the rear control shaft, a main driving unit for driving the rear control shaft, vibration sensors that measure the vibration of each cylinder corresponding to the front cam unit and the rear cam unit and output a corresponding signal, and a controller for controlling the operation of the main driving unit and the phase controller according to the output signals of the respective vibration sensors.
US11939883B2
An airfoil includes an airfoil section that has an airfoil wall that defines a leading end, an arced trailing end, and first and second sides that join the leading end and the arced trailing end. The first and second sides span in a longitudinal direction between first and second ends. The airfoil wall circumscribes an internal core cavity that includes an exit region that spans between the first and second ends and that opens through the arced trailing end. The exit region includes pedestals arranged in a plurality of longitudinal pedestal rows. At least one of the longitudinal pedestal rows is straight and at least one of the longitudinal pedestal rows is arced.
US11939878B1
A turbomachine component is provided. The turbomachine component formed from an additive manufacturing system. The additive manufacturing system defines an axial build direction, a radial direction, and a circumferential direction. The turbomachine component includes an exterior portion. The exterior portion includes a first end wall, a second end wall, and an outer band extending axially between the first end wall and the second end wall. The turbomachine component further includes an interior portion disposed within the exterior portion. The interior portion includes a self-breaking inner band extending axially between the first end wall and the second end wall. The self-breaking inner band includes a plurality of teeth disposed between the first end wall and the second end wall.
US11939874B2
A valve for an air system in an aircraft engine, comprising: a housing defining a chamber having a valve axis; a body within the chamber about a piston axis collinear with the valve axis, extending from a first surface to a second surface, defining a bore extending from the first to the second surface, having a mating connector defined by the second surface and located radially outward of the bore relative to the piston axis; and a sleeve extending from a first end matingly engaged with the mating connector to a second end along a sleeve axis collinear with the valve axis, the first end axially stacked on the body via the first surface to define a first distance between the first end and the first surface, and via the second surface to define a second distance between the first end and the second surface greater than the first distance.
US11939870B2
A gas-cycle system operable using a Bell-Coleman cycle, the gas-cycle system comprising an expander (23) and a compressor (27) incorporated in a flow path (13). The expander (23) and compressor (27) are integrated in a rotary machine (41), and each comprises a rotor assembly (70) configured to define one or more zones (80) each of which changes continuously in volume during a rotation cycle of the rotor assembly. The expander (23) and compressor (27) are drivingly interconnected whereby rotational drive applied to one is transmitted directly to the other. Each rotor assembly (70) comprises an inner rotor (73) and an outer rotor (75) adapted to rotate about parallel axes at different rotational speeds. The inner rotors (73) are each drivingly connected to a common shaft for rotation therewith. The two outer rotors (75) are coupled together such that rotational drive applied to one is transmitted directly to the other. An air-cycle system and an air conditioning system (10) based on the gas-cycle system are also disclosed.
US11939869B2
Provided is a mineral bit and cutting tip therefor. The mineral bit is configured to penetrate geological materials in a dig face to effectively process the same. The mineral bit includes various geometric constraints to increase structural integrity and penetration capability. The cutting tip may have increased durability and may be self-sharpening.
US11939863B2
A method includes deploying an optical fiber attached to a distributed acoustic sensing (DAS) interrogator in a wellbore, pre-setting gauge length of the DAS interrogator based on an expected measurement signal, interrogating the optical fiber using the DAS interrogator, receiving reflected DAS signals along a length of the optical fiber using the pre-set gauge length, performing an analysis to estimate a location and a magnitude of a strain source associated with the reflected DAS signals, and dynamically adjusting the gauge length for at least a portion of the optical fiber within a pre-defined limit of the DAS interrogator as a function of the estimated location and magnitude of the strain source to enhance sensitivity and to optimize signal-to-noise ratio.
US11939861B2
A lead-free pinscreen imprint device for retrieving at least one imprint of a topmost surface of a fish located in a wellbore may include a housing with a central aperture that extends along a section of a central axis thereof. The lead-free pinscreen imprint device may include a pinscreen portion disposed in the housing. The pinscreen portion may include various pins that are disposed along a vertical axis that is parallel to the central axis. The pinscreen portion may include an imprint surface that faces in a downward direction and a scanning surface that faces in an upward direction. The lead-free pinscreen imprint device may include a three-dimensional (3D) laser image scanner disposed in the housing at a location that is immediately above the pinscreen portion. The 3D laser image scanner may be configured to scan the scanning surface and identify any depth changes in the scanning surface.
US11939855B2
A diverting agent and method for temporarily filling fractures. The diverting agent contains a powder-like polyvinyl alcohol-based resin (P1) and a pellet-like polyvinyl alcohol-based resin (P2), and has an adsorption coefficient kc of 0.01 or more and 1 or less.
US11939852B2
The present invention provides a method and system for providing on-site electrical power to a fracturing operation, and an electrically powered fracturing system. Natural gas can be used to drive a turbine generator in the production of electrical power. A scalable, electrically powered fracturing fleet is provided to pump fluids for the fracturing operation, obviating the need for a constant supply of diesel fuel to the site and reducing the site footprint and infrastructure required for the fracturing operation, when compared with conventional systems.
US11939851B2
A downhole tool includes a body including a microwave generator, a susceptor shell connected to the body, and a thermometer connected to the body. The susceptor shell includes a wall made of a susceptor material and a cavity formed between the wall and the body. A system includes a well extending from a surface, a microwave heating tool positioned in the well, and an electrical cable extending from a power source at the surface to the microwave heating tool. A method of treating condensate buildup in a well includes lowering a microwave heating tool into the well to a treatment zone including accumulated condensates, providing power to the microwave heating tool via an electrical cable, increasing a temperature of the treatment zone to an elevated temperature using heat generated by the microwave heating tool, and removing the accumulated condensates in the treatment zone.
US11939850B2
A treatment system comprises a treatment bladder associated with a volume of a tubing-casing annulus of a wellhead system to be treated. The treatment bladder contains a treatment fluid and is at an elevated pressure. The treatment bladder is coupled to the tubing-casing annulus utilizing a fluid conduit through a lower fluid junction. The fluid conduit permits two-way fluid communication between the treatment bladder and the tubing-casing annulus. A method for treating the tubing-casing annulus includes coupling the treatment bladder containing the treatment fluid of the treatment system to the tubing-casing annulus of the wellhead system using the fluid conduit, establishing two-way fluid communication between the tubing-casing annulus and the treatment bladder though the fluid conduit, halting fluid communication though the fluid conduit, and decoupling the treatment bladder from the tubing-casing annulus.
US11939843B2
Provided is a wellbore scraper assembly for use with a wireline. The wellbore scraper assembly, in one example, includes a tubular housing, a plurality of hydraulically deployable scraper features associated with the tubular housing, the plurality of hydraulically deployable scraper features configured to move from a first retracted state to a second radially extended state, and a hydraulic deployment system coupled to the plurality of hydraulically deployable scraper features, the hydraulic deployment system configured to move the plurality of hydraulically deployable scraper features from the first state to the second state.
US11939839B2
A valve arrangement is for a downhole apparatus having a tubular body having first and second ports in a wall thereof. The valve arrangement comprises a first valve arrangement comprising a first valve member associated with the first port of the tubular body; and a second valve arrangement comprising a second valve member associated with the second port of the tubular body. The first valve arrangement and the second valve arrangement are configurable to lock in a first configuration with the tubular body, such that the first port is closed and the second port is closed; to lock in a second configuration with the tubular body, such that the first port is open and the second port is closed; and to lock in a third configuration with the tubular body, such that the first port is closed and the second port is open.
US11939838B2
An ingress-barrier assembly for use with pressure-operated downhole equipment can be used to limit hydraulic fluid flow in a wellbore environment for completions and operations through the life of a well. An assembly can comprise a first port to communicate hydraulic fluid with a first fluid conveyance line. The assembly can include a second port to communicate hydraulic fluid with a second fluid conveyance line. The assembly can further include a first-end stop, a second-end stop, and a moveable seal. The moveable seal can move within a bore of the assembly between the first-end stop and the second-end stop to communicate pressure between the first port and the second port.
US11939830B2
A tool, system and associated methodorient core samples extracted during borehole drilling intended to be coupled to a core barrel and/or to the cable of a head assembly, which at least include electronic processing means provided with at least one processing unit and orthogonally coupled triaxial accelerometers communicated with the processing unit, configured to record data on the movement and/or instantaneous vibration of the tool, which further includes orthogonally coupled micromechanical gyroscopes, configured to rotate relative to an axis of rotation of the tool and transmit the orientation data to the processing unit, wherein the processing unit is configured to, from the data of the set of triaxial accelerometers and the set of micromechanical gyroscopes, calculate the orientation of the core sample with respect to true north and the trajectory of the drilled borehole.
US11939829B2
A setting tool for actuating a downhole component includes an inner tubular configured to be connected in fluid communication with a borehole string, a housing configured to define a first fluid chamber and a second fluid chamber isolated from the first fluid chamber and in fluid communication with the inner tubular, and a setting piston in pressure communication with the second fluid chamber. The setting tool includes a metering module coupled to the housing and disposed at an end of the first fluid chamber, the metering module including a fluid path forming a restriction therein, and an outlet connected to the fluid path. The outlet is configured to be opened to permit fluid to flow out of the first chamber at a controlled rate to generate a differential pressure between the first and second chambers that causes the setting piston to apply a gradually increasing force on the component.
US11939826B2
A wellhead adapter assembly is disclosed. A wellbore adapter is designed for connection to a drillstring, with a riser fluidly connected to the wellbore adapter. At least one tubular arm section is rotatably and fluidly connected to the riser. A positioning system is attached to the at least one tubular arm. The positioning system is adapted to maintain the at least one tubular arm in a desired position relative to the riser, despite relative movement between the drillstring and a floating structure such as a drilling rig.
US11939824B2
A tong for handling a tubular includes a jaw carrier having an active jaw movable from a retracted position to an extended position relative to the jaw carrier; a cam body disposed about the jaw carrier and rotatable relative to the cam body; and a brake assembly including an first brake member for engaging an upper surface coupled to the jaw carrier.
US11939823B2
One illustrative production/annulus bore stab disclosed herein includes a one-piece body that comprises a first cylindrical outer surface and a second cylindrical outer surface and a plurality of individual fluid flow paths defined entirely within the one-piece body. In this illustrative example, each of the individual fluid flow paths is fluidly isolated from one another and each of the fluid flow paths comprise a first inlet/outlet at a first end of the fluid flow path that is positioned in the first cylindrical outer surface and a second inlet/outlet at a second end of the fluid flow path that is positioned in the second cylindrical outer surface.
US11939817B2
The present discloses an automatically locked retractable protective door sill, including a retractable curtain assembly, a scroll assembly, an upper fixing base and a lower fixing base, a dial mechanism and a locking mechanism are arranged in the upper fixing base, the locking mechanism includes a hydraulic rod capable of retracting at a fixed time, and the hydraulic rod is connected to the dial mechanism; the sliding base is connected to the hydraulic rod, and the hydraulic rod drives the sliding base and drives the linkage base to reset automatically, so the automatic locking of the locking mechanism is achieved, and then the scroll assembly is locked. The whole device has a simpler structure and more convenient operation, the dial button may be manually pushed to return for locking after not reaching the set time, so as to prevent children opening the door sill during an automatic locking process.
US11939813B2
A window covering includes a tilt mechanism positionable in a first rail. The tilt mechanism includes a tilt shaft gear, a control gear, and a wand connector. An upper end of the wand connector has a hole in communication with a channel defined in a body of the wand connector such that a central projection of the control gear is insertable into the wand connector via the hole and the channel. A plurality of protrusions extend from the body of the wand connector around a periphery of the body of the wand connector. Each of the protrusions can have an upper surface configured to contact a respective one multiple prongs that extend from the control gear to engage the prongs to facilitate a direct connection of the wand connector to the control gear.
US11939805B2
A door drive for a motor vehicle door or motor vehicle flap, which is provided with an electromotive drive, a transmission downstream of the drive, and a force-transmission element. The force-transmission element is operatively connected to a leaf of the motor vehicle door or motor vehicle flap. An output element of the transmission and the force-transmission element are coupled by a toothing with compensation for play. According to the invention, the output element and/or the force-transmission element are not only designed to be moveable for play compensation, but can also be permanently fixed after the compensation for play.
US11939801B2
A hinge bracket assembly includes an anchor plate. A retention member extends perpendicular to the anchor plate. The anchor plate defines a first receiving aperture. A hinge plate is aligned with the anchor plate and includes a hinge arm and a protrusion. The protrusion extends from an edge of the hinge plate opposite the hinge arm. The hinge plate defines a second receiving aperture aligned with the first receiving aperture when the protrusion is received by a space defined by the retention member. A locking arm is rotatable between an unlocked position and a locked position and is configured to be at least partially received by the first and second receiving apertures to couple the anchor plate and the hinge plate.
US11939796B2
A dock for a portable electronic device includes a base and a first arm supported by the base. The first arm includes a first hook coupled to an end of the first arm. The first hook is configured to engage a first edge of the portable electronic device. The dock further includes a second arm supported by the base. The second arm includes a side door movably coupled to an end of the second arm. The side door has a second hook configured to engage a second edge of the portable electronic device. The side door is movable between a first position, in which the portable electronic device is secured to the dock, and a second position, in which the portable electronic device is removable from the dock.
US11939788B2
A fence panel configured to occupy an opening between adjacent pickets of a fence, the fence panel comprising a primary panel, a suspension panel extending substantially horizontally from an upper portion of the primary panel and above a rail of the fence, a vertical portion extending downwardly from the suspension panel behind the rail, a horizontal tab configured to wrap about the rail, at least one flange extending from the primary panel and at least one vertical tab extending from the at least one flange and configured to wrap about a picket.
US11939781B2
A module for a fall protection system comprises a structural sheet having a ridge and an attachment panel extending laterally therefrom and one or more attachment sections. The attachment panel can be secured to a structure. The module has one or both of: (i) an anchorage connector attached to the ridge at an attachment section; and (ii) a rail clamp having a sleeve portion and a leg portion attached to the ridge at an attachment section; a rail extending through and supported by the sleeve portion; and a slider supported on the rail. The slider is slideably movable along the rail and has a slider anchorage connector. The ridge may be received in a flashing ridge having a flashing extending laterally therefrom to provide coverage for the attachment panel. A person may be attached to the anchorage connector or the slider anchorage connector via a safety line.
US11939771B2
Support members for a roof system are provided to allow for positioning panels of a roof apart from building members so that building components, such as insulation may be placed between the roof panels and the building members. The support members may be utilized in new buildings or to retrofit existing buildings. Each of the support members may comprise a single support member that has a base portion operatively coupled to an offset portion that is operatively coupled to an upper portion. One or more channels may be provided in the base portion, offset portion, and/or the upper portion to provide structural support and to allow the support members to be operatively coupled to each other and other building members without the need for additional components.
US11939767B1
A cap and tube or seal setting apparatus comprises an anchor holding fixture having a surface for receiving a post tension anchor. An actuator is operably mounted to one side of the anchor holding fixture and in some embodiments has a cap setter attached to a movable part of the actuator. In some embodiments a tube or seal holding fixture is mounted to a support base and disposed on an opposed side of the anchor holding device.
US11939764B2
Provided is a ventilation member suitable for ensuring the ventilation of a ventilation layer provided on the back side of a wall material. A ventilation member X according to the present invention is a ventilation member that can be attached to a wall material, and includes a fixed plate portion 10, a top plate portion 20, a partition plate portion 30, a bottom plate portion 40, a front plate portion 50, and a first baffle plate portion 61. The fixed plate portion 10 has a first surface that abuts against a building framework, and a second surface on a side opposite to the first surface, and includes a first end portion 13 located on one side in a state in which the ventilation member X is attached to the wall material, and a second end portion 14 located on another side. The top plate portion 20 extends from the first end portion 13 of the fixed plate portion 10 on the second surface side. The partition plate portion 30 extends from the top plate portion 20 in a direction from the first end portion toward the second end portion of the fixed plate portion 10. The bottom plate portion 40 extends from the partition plate portion 30 in a direction away from the fixed plate portion 10. The front plate portion 50 extends from the bottom plate portion 40 in a direction from the second end portion toward the first end portion of the fixed plate portion 10. The first baffle plate portion 61 extends from the front plate portion 50 to the partition plate portion 30 side. The bottom plate portion 40 has a first hole 42. A wall material construction structure Y1 according to the present invention includes such a ventilation member X.
US11939749B2
An apparatus, system, and method for the extraction of water molecules from the air includes a combination of electrical mechanisms and materials engineering. With the help of hydrophobic and hydrophilic materials on an array of thermally conductive and electrically insulated materials, the extraction of water from the air is significantly increased. A combination of hydrophobic and hydrophilic materials and an electric field gradient moves the water molecules towards the collection system thus speeding up the water formation process. This also inhibits the re evaporation of the water droplets.
US11939745B2
An electrically driven construction machine is provided in which, in a case where a plurality of electrically driven construction machines operate simultaneously, it is possible to avoid exceeding the allowable electric power that can be output by the electric power receiving facility of a commercial electric power supply. A controller computes an own demanded power Pd1 for driving the plurality of hydraulic actuators, on the basis of operation signals of the operation devices, computes an allowable power as a power limit value usable by the electric motor on the basis of the own demanded power, the demanded powers of the other electrically driven construction machines received through the communication device, and an allowable electric power of the electric power receiving facility of the commercial electric power supply, and controls the electric motor such that a power consumption of the electric motor does not exceed the allowable power.
US11939733B2
A cable barrier system is managed by a cable barrier management system including a management system controller having a management processor and a plurality of turnbuckle subsystems joined to respective barrier cables to provide pretension. Each of the turnbuckle subsystems has a strain gauge mounting zone, and strain is communicated from a strain gauge circuit to the management processor. The controller is configured to determine excess strain events. Strain event data is sent via a wireless data communications interface to a remote recipient computing device.
US11939725B2
A hot-extraction paper consisting substantially of cellulose and manufacturing assistants needed in cellulose and manufacturing assistants needs in cellulose production, such as pH modifiers based on acids and/or bases, the paper comprises exclusively cellulose having fibre lengths of at least 2.0 mm on length-weighted average, more particularly at least 2.5 mm on length-weighted average, and has isotropic extension properties which are substantially equal in machine and cross directions and amount to at least 7.5%, more particularly at least 8.5%.
US11939717B2
An appliance includes a cabinet defining at least one chamber accessible via an opening. The appliance also includes a cover member movable between an open position and a closed position for providing selective access to the opening. The appliance includes a hinge assembly constructed of a polymer material and operably coupled to the cover member. The hinge assembly includes first and second hinge members. The first hinge member is fixedly secured to the cabinet. The second hinge member includes a base portion fixedly secured to cover member and a pin portion. The pin portion is rotatably secured to the first hinge member to move the cover member between the open and closed positions. In the open position, the first and second hinge members cooperatively engage together to restrict movement of the cover member in the open position. In the closed position, the cabinet restricts movement of the cover member.
US11939716B2
Disclosed is a clothes treating apparatus including a drum configured to receive laundry, a tub in which the drum is built, a main body in which the drum and the tub are disposed, detergent drawer compartments provided in the main body to be withdrawn from or inserted in the main body, a spray nozzle configured to spray washing water to the detergent drawer compartments, a water-collecting container disposed below the tub to receive the washing water, a washing line configured to supply the washing water of the water-collecting container to the spray nozzle, a circulation line configured to supply the washing water of the water-collecting container into the drum, and a flow-path conversion pump configured to receive the washing water from the water-collecting container and supply the washing water selectively to the washing line or the circulation line.
US11939715B2
A liquid discharge apparatus includes a liquid discharge head including a nozzle face in which a nozzle is formed and configured to discharge a liquid, a carriage on which the liquid discharge head is mounted, and a guide shaft configured to hold the carriage movably. The liquid discharge apparatus further includes a driver configured to move the carriage, and a coupling between the carriage and the driver. The coupling is disposed on an axis of the guide shaft in a direction orthogonal to the axis of the guide shaft.
US11939705B2
Present invention teaches a bamboo fabric shade that is woven in a weft and warp fashion from a plurality of bamboo filaments. An alternative embodiment of dual bamboo filaments as a single unit for the weaving is done in a similar fashion. Each bamboo filament has a high molecular mass bamboo thread inside a layer of coating wherein the coating is made to be thicker at a middle node section with the thickness tapering off towards the two distal ends of the high molecular mass bamboo thread. The coating uses PVC material, with optional addition of UV-absorbent materials. Such construction of the bamboo fabric adds to the reduction of light pollution when used for home decoration purposes.
US11939694B2
The present invention relates to a method for coating a component of a turbomachine in a bath, in which method, the component is partially immersed in the bath containing a coating material; the component is rotated at least intermittently around an axis of rotation, which lies outside of the bath, during the at least partial immersion; the component is at most immersed partially over and beyond the rotation.
US11939688B2
Photoelectrochemical (PEC) technology for the conversion of solar energy into chemicals may require cost-effective photoelectrodes to efficiently and stably drive anodic and/or cathodic half-reactions to complete the overall reactions for storing solar energy in chemical bonds. Apparatus and systems incorporating effectively transparent metal catalysts enable the design and/or implementation of PEC devices for light harvesting. Triple-junction photocathodes with the triangular catalyst grids are provided to improve the efficiency of the photocathodes to generate renewable fuel from sunlight.
US11939682B2
The embodiments of the present disclosure relate to a method and apparatus for producing a carbon nanomaterial product (CNM) product that may comprise carbon nanotubes and various other allotropes of nanocarbon. The method and apparatus employ a consumable carbon dioxide (CO2) and a renewable carbonate electrolyte as reactants in an electrolysis reaction in order to make CNTs. In some embodiments of the present disclosure, operational conditions of the electrolysis reaction may be varied in order to produce the CNM product with a greater incidence of a desired allotrope of nanocarbon or a desired combination of two or more allotropes.
US11939681B1
A a plant composite corrosion inhibitor for an oil field and a preparation method thereof belong to the technical field of preparation of oil field chemical agents. The plant composite corrosion inhibitor comprises a first plant ingredient, a second plant ingredient, a corrosion inhibition synergist and an organic solvent. The first plant ingredient is zeaxanthin and a derivative thereof obtained by supercritical CO2 extraction of marigold; the second plant ingredient is prepared from luffa leaves, guava leaves and eclipta according to a mass ratio of 5:8:9; the corrosion inhibition synergist is prepared by mixing potassium iodide, 8-hydroxyquinoline and sodium dodecyl benzene sulfonate according to a mass ratio of 3:4:2; and the organic solvent is ethanol with a mass concentration of 82%. The composite corrosion inhibitor has a good corrosion inhibition effect, and reduces harmful chemical ingredients in the corrosion inhibitor.
US11939674B2
Exemplary deposition methods may include delivering a silicon-containing precursor and a boron-containing precursor to a processing region of a semiconductor processing chamber. The methods may include providing a hydrogen-containing precursor with the silicon-containing precursor and the boron-containing precursor. A flow rate ratio of the hydrogen-containing precursor to either of the silicon-containing precursor or the boron-containing precursor is greater than or about 1:1. The methods may include forming a plasma of all precursors within the processing region of a semiconductor processing chamber. The methods may include depositing a silicon-and-boron material on a substrate disposed within the processing region of the semiconductor processing chamber.
US11939665B2
A film thickness measurement apparatus includes: a stage that places a substrate having a film formed thereon and measures a thickness of the film in-situ in a film forming apparatus; a film thickness meter including a light emitter that emits light toward the substrate disposed on the stage and a light receiving sensor that receives the light reflected by the substrate for measuring the thickness of the film in-situ; a moving mechanism including a multi-joint arm that moves an irradiation point of the light on the substrate; a distance meter that measures a distance between the light receiving sensor and the irradiation point on the substrate; and a distance adjustor that adjusts the distance between the light receiving sensor and the irradiation point on the substrate.
US11939640B2
A method for producing a hot-rolled steel sheet, a method for producing a cold-rolled full-hard steel sheet, and a method for producing a heat-treated sheet are provided herein. The methods comprising hot rolling a steel material of a composition comprising, in mass %, C: 0.05 to 0.12%, Si: 0.80% or less, Mn: 1.30 to 2.10%, P: 0.001 to 0.050%, S: 0.005% or less, Al: 0.01 to 0.10%, N: 0.010% or less, one or more selected from Cr in an amount of 0.05 to 0.50%, and Mo in an amount of 0.05 to 0.50%, one or more selected from Ti in an amount of 0.01 to 0.10%, Nb in an amount of 0.01 to 0.10%, and V in an amount of 0.01 to 0.10%, and the balance Fe and unavoidable impurities.
US11939637B2
In one aspect, provided herein is a method comprising: (a) (i) determining cytolytic activity in a tumor from the subject; and/or (ii) determining genetic alterations associated with cytolytic activity in the tumor; and (b) administering an immunotherapeutic agent to the subject if (i) cytolytic activity is detected in the tumor and/or (ii) a genetic alteration associated with induction of cytolytic activity, tumor resistance to cytolytic activity and/or suppression of cytolytic activity is detected in the tumor.
US11939633B2
A COTL1 gene or protein maintains and regulates the homeostasis of hematopoietic stem cells. A method of diagnosis and treatment of blood-related disease caused either by abnormalities in the homeostasis of hematopoietic stem cells, which result from a mutation in the COTL1 gene or a decrease in the expression of the COTL1 protein, or by an imbalance between the differentiation or proliferation and damage or death of hematopoietic stem cells, or by abnormalities in mitochondrial homeostasis are disclosed. The COTL1 gene or protein plays an important role in regulating mitochondrial morphology, and when it is knocked down, the number of hematopoietic stem cells decreases.
US11939625B2
A method and a sensor for detecting L-cystine are disclosed. The method is implemented by assembling a sodium 3,3′-dithiodipropane sulfonate (SPS) membrane on a surface of Au membrane layer of an Au electrode and using an extended gate of field effect transistor (FET) and in-situ signal amplification of the FET to detect L-cystine sensitively. The polyanion of the SPS membrane adsorbs and binds a positively charged target L-cystine through electrostatic interaction, thus forming an electric double layer structure to generate a membrane potential identifying a monovalent organic ammonium ion. The sensor includes the FET, wherein a gate-extended gold electrode is arranged on the FET, and the SPS membrane is assembled on the surface of the Au membrane layer of the gate-extended gold electrode. The sensor has an excellent Nernst response to L-cystine.
US11939613B2
The present disclosure relates to the production of cannabinoids in yeast. In as aspect there is provided a genetically modified yeast comprising: one or more GPP producing genes and optionally, one or more GPP pathway genes; two or more olivetolic acid producing genes; one or more cannabinoid precursor or cannabinoid producing genes; one or more Hexanoyl-CoA producing genes, and at least 5% dry weight of fatty acids or fats.
US11939606B2
A new CRISPR-associated (Cas) protein, termed “CasM,” is described, as well as polynucleotides encoding the same and methods of using CasM for site-specific genome engineering. CasM proteins are capable of targeting and cleaving single-stranded RNA.
US11939600B2
This invention provides a range of translatable polynucleotide and oligomer molecules for expressing a human phenylalanine hydroxylase (PAH), or a fragment thereof having PAH activity. The polynucleotide and oligomer molecules are expressible to provide the human PAH or a fragment thereof having PAH activity. The molecules can be used as active agents to express an active polypeptide or protein in cells or subjects. The agents can be used in methods for ameliorating, preventing, delaying onset, or treating a disease or condition associated with phenylketonuria, decreased metabolism of phenylalanine, or increased levels of phenylalanine in a subject.
US11939595B2
This disclosure provides nano-scale Artificial Antigen Presenting Cells (aAPC), which deliver stimulatory signals to lymphocytes, including T-helper lymphocytes, for use as a powerful tool for immunotherapy.
US11939580B2
A self-circularization RNA construct that can be expressed in a DNA vector and simultaneously circularized through a self-targeting and splicing reaction to form a circRNA is disclosed. The circRNA can consist only of a gene of interest which can be a coding, non-coding, or a combination thereof. The gene of interest has the advantage of being able to rapidly express a peptide or protein. The formed circRNA has a circular structure and has a stable and high half-life because 5′ and 3′ ends are not exposed. Accordingly, functional RNA such as miRNA, anti-miRNA, siRNA, shRNA, aptamer, functional RNA for gene/RNA editing, ADAR (adenosine deaminase acting on the RNA)-recruiting RNA, mRNA vaccine, mRNA therapeutic agent, vaccine adjuvant, and CAR-T mRNA can be produced as a stable circRNA in cells.
US11939579B2
The present invention relates to a tissue-specific promoter system for expressing microRNA (miRNA) for RNA interference-based methods of gene therapy. In these systems, the miRNA will inhibit gene expression or replace natural miRNA expression using microRNA.
US11939578B2
The present invention relates to the field of biomedicine, particularly to double-stranded RNA molecules targeting CKIP-1 and uses thereof, particularly to use of the double-stranded RNA molecules for the treatment of inflammatory diseases such as arthritis, particularly rheumatoid arthritis.
US11939575B2
Provided are compositions and methods for altering gene expression in cells. The compositions and methods may utilize a nucleic acid sequence that has a genetically modified trans-activating crRNA (tracrRNA) sequence, where at least one uracil nucleotide of the tracrRNA sequence is replaced with a nucleotide other than uracil, and/or a nucleic acid sequence that has a guide RNA (gRNA) sequence wherein one or more cytosine nucleotides and/or one or more uracil nucleotides of said gRNA sequence are modified nucleotides. Also provided are methods of treating a disorder in a subject in need of the treatment. The method may involve administering to the subject the nucleic acid or a vector thereof in combination with an RNA-guided DNA endonuclease enzyme.
US11939572B2
The invention relates to a chimeric antigen-receptor polypeptide heterodimer comprising two polypeptides, wherein the first contains an extracellular part of the major histocompatibility complex I alpha chain and the second contains a 32-microglobulin domain, or the first contains an extracellular part of the major histocompatibility complex II alpha chain and the second contains a major histocompatibility complex II beta chain. One of the polypeptides further contains a transmembrane domain, a hinge region and an intracellular domain of the T cell receptor alpha chain and the other one contains a transmembrane domain, a hinge region and an intracellular domain of the T cell receptor beta chain, and additionally an antigen-peptide covalently linked to said extracellular MHC domain. The invention further relates to a method for the identification of a TCR recognizable peptide sequence making use of the heterodimer of the invention.
US11939570B2
A microfluidic lab-on-a-chip system for DNA gene assembly that utilizes a DNA symbol library and a DNA linker library. The lab-on-a-chip has a fluidic platform with a plurality of arrays operably connected to a voltage source and a controller for the voltage source, a set of first inlets operably connected to the fluidic platform, each first inlet for one DNA symbol from a DNA symbol library, a set of second inlets operably connected to the fluidic platform, each second inlet for one DNA linker from a DNA linker library, and a mixing area operably connected to the fluidic platform and to the plurality of first inlets and the plurality of second inlets.
US11939567B2
Reactors, systems and processes for the production of biomass by culturing microorganisms in aqueous liquid culture medium circulating inner loop reactor which utilize nonvertical pressure reduction zones are described. Recovery and processing of the culture microorganisms to obtain products, such as proteins or hydrocarbons is described.
US11939565B1
Provided herein is a method for incubating living cells, in accordance with principles of the disclosure, may include the steps of: (a) providing a pressurized gas to a medium reservoir, the pressurized gas providing an impetus that moves a growth medium in the medium reservoir to a bioreactor chamber via a first incoming fluid line connecting the medium reservoir to the bioreactor chamber; (b) simultaneously or subsequently to step (a), providing a pressurized gas to a cell reservoir holding a suspension of the living cells, the pressurized gas providing an impetus that moves the suspension to the bioreactor chamber via a second incoming fluid line connecting the cell reservoir to the bioreactor chamber; and (c) incubating the growth medium and the living cells in the bioreactor chamber, under conditions compatible with cell viability.
US11939555B2
A fabric care composition is provided including water; a modified carbohydrate polymer having a weight average molecular weight of <500,000 Daltons and a Kjeldahl nitrogen content corrected for ash and volatiles, TKN, of ≥0.5 wt %; and a cleaning surfactant; wherein the modified carbohydrate polymer is a carbohydrate polymer functionalized with quaternary ammonium moieties; wherein the quaternary ammonium moieties on the modified carbohydrate polymer include: trimethyl ammonium moieties having formula (I) and dimethyl(alkyl) ammonium moieties having formula (II) wherein each R is independently selected from a C8-22 alkyl group.
US11939553B2
Disclosed are detergent compositions and methods of cleaning articles and/or membranes using the surfactants herein. Compounds, compositions, and methods for using these compounds and compositions in detergent or cleaning compositions are also provided. These compounds, compositions, and methods are particularly directed to cleaning compositions and methods that have advantageous cleaning properties at a pH of 7 or less. In particular, the compounds, compositions, and methods described herein can also be used as general surfactants in detergent compositions or in methods of cleaning articles or membranes.
US11939552B2
The present invention relates to processes of recovering oil after liquefaction and/or from thin stillage and/or syrup/evaporated centrate from a fermentation product production process by adding a thermostable protease to the whole stillage, thin stillage and/or syrup.
US11939551B1
An electric motor driveline fluid for an electric motor system including a lubricating base oil, at least one sulfurized component, and at least one dispersant derived from a polyisobutylene having an average number molecular weight of at least 2000. The electric motor driveline fluid provides acceptable wear performance as well as good electrical conductivity and oxidative stability for use in electric motor system fluids having a low viscosity when select elemental relationships of phosphorus, sulfur, and calcium and included in the fluid.
US11939548B2
A nanostructure includes a plurality of substantially spherically curved carbon layers having diameters in a range of 1 nanometer to 1000 nanometers and a plurality of halogen atoms attached to an outer convex side of the carbon layers. A composition of matter includes a liquid fuel and an additive including at least one liquid and a plurality of carbon nano-onions. A method of fabricating an additive for liquid fuel includes creating a carbon-based material using a plasma in an environment including at least one hydrocarbon gas and/or at least one liquid containing hydrocarbons, organometallic metal-complex, and/or element-organic compounds, evaporating organic material from the carbon-based material, halogenating the carbon-based material, and extracting carbon nano-onions from the halogenated carbon-based material.
US11939543B2
In an embodiment, a method for decreasing reactor fouling in a steam cracking process is provided. The method includes steam cracking a hydrocarbon feed to obtain a quench oil composition comprising a concentration of donatable hydrogen of 0.5 wt. % or more based on a total weight percent of the quench oil composition; exposing a steam cracker effluent flowing from a pyrolysis furnace to the quench oil composition to form a mixture; and fractionating the mixture in a separation apparatus to obtain a steam cracker tar. In another embodiment, a hydrocarbon mixture is provided. The hydrocarbon mixture includes a mid-cut composition.
US11939538B2
In accordance with one or more embodiments of the present disclosure, a method for producing aromatic compounds from pyrolysis gasoline comprising C5-C6 non-aromatic hydrocarbons includes aromatizing the pyrolysis gasoline in an aromatization unit, thereby converting the C5-C6 non-aromatic hydrocarbons to a first stream comprising benzene-toluene-xylenes (BTX); hydrotreating the first stream comprising BTX in a selective hydrotreatment unit, thereby producing a de-olefinated stream comprising BTX hydrodealkylating and transalkylating the de-olefinated stream comprising BTX in a hydrodealkylation-transalkylation unit, thereby producing a second stream comprising BTX, the second stream comprising BTX having a greater amount of benzene and xylenes than the first stream comprising BTX; and processing the second stream comprising BTX in an aromatics recovery complex, thereby producing the aromatic compounds from the pyrolysis gasoline, the aromatic compounds comprising benzene, toluene, and xylenes.
US11939534B2
A composition having a recycle content value is obtained by reacting a recycle content feedstock to make a recycle content alpha olefin or by deducting from a recycle inventory a recycle content value applied to an alpha olefin composition. At least a portion of the recycle content value in the feedstock or in an allotment obtained by an alpha olefin manufacturer has its origin in recycled waste and/or pyrolysis of recycled waste and/or in thermal steam cracking of recycle content pyoil.
US11939510B2
The invention relates to a polymerisable LC material comprising at least one di- or multireactive mesogenic compound of formula T, RT1-(AT1ZT1)m1-GT1-(ZT2-AT2)m2-RT2 T and at least one compound of formula CO-1, wherein the parameter are RT1, AT1, ZT1, m1, GT1, ZT2, AT2, m2, RT2, L1 to L3, R1 and R2, and n are defined as given in claim 1. Furthermore, the present invention relates also to a method for its preparation, a polymer film with improved thermal durability obtainable from the corresponding polymerisable LC material, to a method of preparation of such polymer film, and to the use of such polymer film and said polymerisable LC material for optical, electro-optical, decorative or security devices.
US11939506B1
A method of reducing salinity of saline soil, comprising providing a sawdust and corn stover-based biochar, contacting the sawdust and corn stover-based biochar with a saline soil, and adsorbing salts in the soil with the sawdust and corn stover-based biochar. The sawdust and corn stover-based biochar can be prepared by hydrothermally carbonizing a mixture including equal proportions of corn stover and sawdust.
US11939505B2
Provided are a silicon nitride film etching composition, a method of etching a silicon nitride film using the same, and a manufacturing method of a semiconductor device. Specifically, a silicon nitride film may be stably etched with a high selection ratio relative to a silicon oxide film, and when the composition is applied to an etching process at a high temperature and a semiconductor manufacturing process, not only no precipitate occurs but also anomalous growth in which the thickness of the silicon oxide film is rather increased does not occur, thereby minimizing defects and reliability reduction.
US11939502B2
The present disclosure relates to quantum dots with a core of III-V material, a first layer of II-VI material and an external shell of II-VI material to be used, for example, in downconverters. The external shell is preferably made of an alloy of Zn and Cd with Se or S. Introducing a small amount of Cd in the external shell provides excellent absorbance performance in blue, violet and UV wavelengths. The amount of Cd needed for this increase in absorbance can be very low. Further, the emitted light can be nearly monochromatic, which is especially interesting in electronic applications.
US11939497B2
Provided is: a layered body wherein a sheet surface has slight adhesiveness, enabling easy temporary securing of a semiconductor chip, or the like, that has been diced, onto a semiconductor substrate, and wherein permanent adhesion to an adhered object is expressed through post-curing; a layered body that includes the same; a semiconductor device that uses the same; and a method for manufacturing the semiconductor device. A silicone-based adhesive sheet is disclosed herein, wherein, prior to heating, the delamination mode of the adhesive surface from a non-adhesive substrate is interfacial delamination, and after heating of the adhesive surface in a range of between 50 and 200° C., the delamination mode of the adhesive surface from another non-adhesive substrate changes to cohesive fracturing, and exhibits permanent adhesion.
US11939492B2
The present invention provides an adhesive resin composition that has excellent adhesiveness and durability, a method for bonding adherends, and an adhesive resin film. More specifically, the present invention relates to an adhesive resin composition containing more than 50 parts by mass and 99.5 parts by mass or less in a solid content of an acid-modified polyolefin resin having a melting point of 50 to 100° C., 0.5 parts by mass or more and less than 50 parts by mass in a solid content of an epoxy resin having a novolac structure, and an organic solvent; a method for bonding adherends including forming an adhesive layer on a first adherend by applying the adhesive resin composition and drying, and then bonding a second adherend to the adhesive layer by laminating the second adherend on the adhesive layer; and an adhesive resin film including a first adhesive layer, a substrate layer, and a second adhesive layer in that order, in which any one or both of the first adhesive layer and the second adhesive layer include(s) the adhesive resin composition.
US11939488B2
Methods for abating airborne pollutants include applying a coating composition ath includes a an aqueous carrier, a binder, a pigment, and a formaldehyde scrubbing urea compound and curing the coating composition. The coated substrate absorbs formaldehyde and other air pollutants from passing air.
US11939487B2
The present invention discloses a spirooxazine photochromic exterior wall coating, comprising the following components by mass percent: 0.6%-1.5% of spirooxazine photochromic compound, 40%-45% of resin, 0.3%-1% of dispersant, 0.2%-0.3% of antifoamer, 1%-3% of additive, 22%-24% of pigment and 30%-32% of solvent. The additive comprises 0.9 wt %-2 wt % of NaCl or KCl solution. The present invention further provides a preparation method for the spirooxazine photochromic exterior wall coating, comprising measuring, grinding, dispersing, mixing, adjusting pH and filtering. Experiments prove that the spirooxazine photochromic exterior wall coating provided by the present invention has good light fatigue resistance effect and can meet the needs of long-term use of building exterior walls.
US11939484B2
A multi-fluid kit for three-dimensional printing can include a fusing agent with water and a radiation absorber, and a detailing agent. The radiation absorber can absorb radiation energy and converts the radiation energy to heat. The detailing agent can include water and from about 0.1 wt % to about 20 wt % organosilanes based on a total weight of the detailing agent, wherein the organosilanes include an organosilane compound with a central silicon having both a water-solubilizing group and multiple hydrolyzable groups attached thereto.
US11939469B2
Described herein is a method of using copolyamides c) produced by polymerization of components A′) 15% to 84% by weight of at least one lactam, and B′) 16% to 85% by weight of a monomer mixture (M) including components B1′) at least one C32-C40-dimer acid and B2′) at least one C4-C12-diamine, where the percentages by weight of the components A′) and B′) are in each case based on the sum of the percentages by weight of the components A′) and B′), the method including using the copolyamides c) to increase an impact strength and/or breaking elongation of molded articles made of molding materials including thermoplastic polyamides, which are different from copolyamides c).
US11939459B2
An object of the present invention is to provide a photosensitive resin composition having good liquid repellency. The photosensitive resin composition of the present invention at least contains a fluororesin having a crosslinking site, a solvent, and a photopolymerization initiator, and the fluororesin contains a repeating unit derived from a hydrocarbon having a fluorine atom.
US11939456B2
A composition for preparing a foam, a foam, and a shoe employing the foam are provided. The composition for preparing a foam includes 3-30 parts by weight of a first polymer and at least one of a second polymer and a third polymer. The first polymer is cyclic olefin polymer (COP), cyclic olefin copolymer (COC), metallocene based cyclic olefin copolymer (mCOC), fully hydrogenated conjugated diene-vinyl aromatic copolymer, or a combination thereof. The total weight of the second polymer and the third polymer is 70-97 parts by weight. The second polymer is polyolefin, olefin copolymer, or a combination thereof. The third polymer is conjugated diene-vinyl aromatic copolymer, partially hydrogenated conjugated diene-vinyl aromatic copolymer, or a combination thereof. The total weight of the first polymer and at least one of the second polymer and the third polymer is 100 parts by weight.
US11939447B2
A thermosetting composition including a thermosetting compound and hexagonal boron nitride D, wherein the thermosetting compound contains a cyanate compound A and/or a maleimide compound B, and a modified polyphenylene ether C having a substituent with a carbon-carbon unsaturated double bond at at least one terminal, and a content of the hexagonal boron nitride D is 0.1 parts by mass or more and 25 parts by mass or less based on 100 parts by mass of the thermosetting compound.
US11939439B2
The present invention is applicable to a field of a substrate for a high-frequency circuit, and relates, for example, to a composite polyimide film, a producing method thereof, and a printed circuit board using the same. More specifically, the composite polyimide film includes a film matrix including polyimide; and a plurality of filler particles dispersed in the film matrix, wherein each of the filler particles includes an inorganic particle, and a fluorine polymer coating formed on the inorganic particle.
US11939437B2
A method for producing a fiber for reinforcing rubber, comprising applying an adhesion treatment liquid containing a thermoplastic elastomer, a blocked polyisocyanate, and a rubber latex to a fiber cord to obtain a fiber for reinforcing rubber, wherein the thermoplastic elastomer is incorporated in the form of a water dispersion into the adhesion treatment liquid, wherein the thermoplastic elastomer particles in the water dispersion have an average particle diameter of 0.01 to 1.0 μm.
US11939435B2
The present disclosure provides poly(tetrafluoroethylene) (PTFE) microparticles with a Dv50 of about 20 μm to about 30 mm and a specific surface area (SSA) of at least about 3.0 m2/g when measured by a multipoint BET method of ISO 9277. Such PTFE microparticles can be obtained via a method including thermomechanically degrading scrap PTFE in the presence of air and/or oxygen and reducing the particle size of the resultant degraded PTFE.
US11939429B1
Infrared-transparent polymers, useful for LWIR and/or MWIR transparency, are disclosed. The disclosed infrared-transparent polymers are low-cost, damage-resistant, and economically scalable to commercially relevant substrate areas (1 ft2 and greater). In some disclosed infrared-transparent polymers, the carbon-free polymer backbone contains a plurality of polymer repeat units of the form wherein R1 is selected from the group consisting of alkyls, hydroxyl, amino, urea, thiol, thioether, amino alkyls, carboxylates, metals, metal-containing groups, and deuterated forms or combinations thereof; wherein R2 is (independently from R1) selected from the group consisting of alkyls, hydroxyl, amino, urea, thiol, thioether, amino alkyls, carboxylates, metals, metal-containing groups, and deuterated forms or combinations thereof; wherein n is selected from 2 to about 10,000; and wherein the carbon-free polymer backbone is linear, cyclic, branched, or a combination thereof.
US11939413B2
An acrylic resin powder soluble in acetone, including a multi-stage polymer (M) that includes a polymer (B) obtained by polymerizing a monomer mixture (b) containing methyl methacrylate and an alkyl (meth)acrylate ester (mb) in the presence of a polymer dispersion that contains a polymer (A) obtained by polymerizing a monomer mixture (a) containing an alkyl (meth)acrylate ester (ma), in which an alkyl group in the alkyl (meth)acrylate ester (ma) has 4 to 8 carbon atoms, an alkyl group in the alkyl (meth)acrylate ester (mb) has 4 to 8 carbon atoms, a glass transition temperature of the polymer (A) is 20° C. or lower, a glass transition temperature of the polymer (B) obtained by polymerizing the monomer mixture (b) is 55° C. or higher, and a mass average molecular weight of the multi-stage polymer (M) is 10,000 or more and 300,000 or less.
US11939411B2
Ethylene-based polymers of this disclosure include an average g′ less than 0.86, where the average g′ is an intrinsic viscosity ratio determined by gel permeation chromatography using a triple detector; and a molecular weight tail quantified by an MWD area metric, ATAIL, and ATAIL is less than or equal to 0.04 as determined by gel permeation chromatography using a triple detector.
US11939385B2
The present application provides activatable antibodies comprising an antibody comprising an antigen-binding domain (ABD), wherein the ABD comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein the N-terminus of the VH is fused to a first polypeptide shield moiety (S1), and the N-terminus of the VL is fused to a second polypeptide shield moiety (S2), wherein S1 comprises a first disease-sensing releasable moiety (DS1) and/or S2 comprises a second disease-sensing releasable moiety (DS2), wherein association of S1 with S2 blocks binding of the ABD to its target, and wherein the ABD does not specifically bind to S1, S2, or association thereof. Composition, methods of treatment using the activatable antibodies, and methods of preparation thereof are further provided.
US11939380B2
This disclosure relates to combination therapies targeting two or all of PD-1, TIM-3, and LAG-3 using antibodies specific for these targets in patients who are in need of enhanced immunity. Also included in the disclosure are compositions useful in the therapies. The therapies are useful in treating diseases such as cancers.
US11939378B2
The invention features methods of diagnosis by assessing B7-H1 expression in a tissue from a subject that has, or is suspected of having, cancer, methods of treatment with agents that interfere with B7-H1-receptor interaction, methods of selecting candidate subjects likely to benefit from cancer immunotherapy, and methods of inhibiting expression of B7-H1.
US11939372B2
Compositions and methods relating to epitopes of sclerostin protein, and sclerostin binding agents, such as antibodies capable of binding to sclerostin, are provided.
US11939368B2
The present invention is directed to QTY CCR9 and CXCR2 variant Fc receptor fusion proteins, methods for the preparation thereof and methods of use thereof.
US11939367B2
The present invention is based on the seminal discovery that BTLA agonist fusion proteins modulate an immune response. Specifically, the present invention provides fusion proteins that bind BTLA enhancing BTLA signaling. The present invention further provides methods of treating cancer and immune and inflammatory diseases and disorders with a BTLA agonist fusion protein as described herein.
US11939354B1
Fusion peptide inhibitors of human coronavirus 229E are provided. The fusion peptide inhibitors of HCoV-229E include peptide #121 (SEQ ID NO: 2: HVLGDISGINASVVQIQKEIDRLNEVAKNLHESLIYLQE), and peptide #125 (SEQ ID NO: 3: HRLRQIRGIRARVVQIQKEIWRLNEVAKLLNESLIYLQE). The fusion peptide inhibitors of HCoV-229E may be administered to a subject in need thereof to inhibit or prevent HCoV-229E cellular entry or infection with HCoV-229E. The fusion peptide inhibitors of HCoV-229E may also be used in HCoV-229E inhibition assays.
US11939353B2
The present invention relates to fluorinated and alkylated bile acids.
US11939352B2
Biotransformation of an aromatase inhibitor, testolactone (1), yielded four metabolites, 7β-hydroxy-3-oxo-13,17-seco-5β-androsta-1-eno-17,13α-lactone (2), 3α,11β-dihydroxy-13,17-seco-5β-androsta-17,13α-lactone (3), 4β,5β-epoxy-3β-hydroxy-13,17-secoandrosta-1-eno-17,13α-lactone (4), and 4β,5β-epoxy-3α-hydroxy-13,17-secoandrosta-1-eno-17,13α-lactone (5). Aromatase (estrogen synthase) involves in the synthesis of estrogen, and promotes the growth of breast cancerous cells. It is a key target for the discovery of chemotherapeutic agents against ER+(estrogen-positive) breast-cancers. Metabolites 2 (IC50=8.63±0.402 nM), and 3 (IC50=9.23±1.31 nM) were identified as potent inhibitors against human aromatase enzyme, in comparison to 1 (IC50=0.716±0.031 μM), and the standard aromatase inhibiting drug, exemestane (IC50=0.232±0.031 μM). Derivatives 4 (IC50=10.37±0.50 μM) and 5 (IC50=0.82±0.059 μM) also showed a good inhibition against aromatase enzyme. Therefore, metabolites 2-5 have the potential to serve as therapeutic agents against ER+ (estrogen-positive) breast-cancers.
US11939348B2
The invention relates to compounds and compositions for modulation of nicotinamide adenine dinucleotide (NAD+). The invention also relates to methods of making such compounds and compositions. The invention relates to pharmaceutical compositions containing one or more NAD+ modulating compounds as a first ingredient in combination with one or more active pharmaceutical ingredients. Further, the invention relates to methods of using such compounds or compositions to promote the increase of intracellular levels of nicotinamide adenine dinucleotide (NAD+) in cells and tissues for treating diseases and/or improving cell and tissue survival.
US11939344B2
The specification relates to spirocyclic compounds of Formula (I) and pharmaceutically acceptable salts thereof. The specification also relates to processes and intermediates used for their preparation, pharmaceutical compositions containing them and their use in the treatment of cell proliferative disorders.
US11939338B2
The present disclosure relates to a spiropyran composite having improved mechano-sensitivity, a method for manufacturing the same, and a chromic article including the same. Particularly, the spiropyran composite is obtained by bonding spiropyran covalently to a polymer, an inorganic material or a mixture thereof to form spiropyran composite, and impregnating the spiropyran composite with a sensitivity-enhancing agent for a suitable time through a wet infiltration process to form non-polar environment at the inner part of the spiropyran composite, to cause pre-stretch and to increase a change in color or fluorescence in response to force, stress or strain, thereby providing significantly improved mechano-sensitivity. In addition, a wet filtration process is used and no expensive equipment is required to simplify the process. Further, the process can be performed rapidly within several minutes to reduce the processing time.
US11939337B2
Compounds are disclosed that inhibit RhoGTPases that are useful for inhibiting hyperprofilerative and neoplastic diseases. Specifically, the compounds inhibit the GTPases Rac and Cdc42 that are overactive or overexpressed in signaling pathways in cancer and metastasis. Methods for treatment of cancer and hyperproliferative diseases are disclosed.
US11939332B2
Disclosed herein are synthesis methods for coelenterazine. Also disclosed are articles including the coelenterazine and coelenterazine derivatives. Representative absorbent articles include disposable diapers and adult incontinence products.
US11939330B1
Novel pyrido[3,4-b]indole-6-carboxylic acid compounds, a method of synthesizing said compounds, a pharmaceutical composition comprising said compounds and a suitable carrier, and a method of using the compounds. The pyrido[3,4-b]indole-6-carboxylic acid compounds, identified as CK2 inhibitors, are useful as anticancer and/or antitumor agents, and as agents for treating other kinase-associated conditions including inflammation, pain, and certain immunological disorders, and other types of diseases such as diabetes, viral infection, neurodegenerative diseases.
US11939317B2
Disclosed embodiments concern novel interleukin receptor associated kinases (IRAK) inhibitors and compositions comprising such inhibitors. Also disclosed are methods of making and using the compounds and compositions. The disclosed compounds and/or compositions may be used to treat or prevent an IRAK-associated disease or condition.
US11939301B2
Provided herein are compounds of the formula (I): as well as pharmaceutically acceptable salts thereof, wherein the substituents are as those disclosed in the specification. These compounds, and the pharmaceutical compositions containing them, promote mitochondrial biogenesis and are useful for the treatment of, for example, acute kidney injury and chronic kidney disease.
US11939298B1
A 5-(4,5-bis(4-bromophenyl)-2-(4-chlorophenyl)-1H-imidazol-1-yl)pentanoic acid compound, its synthesis, and its use as an antimicrobial agent.
US11939295B1
A 6-(3-hydroxyphenyl)-2-methoxy-4-(3-methylphenyl)nicotinonitrile as an antimicrobial compound, its synthesis, and its use as an antimicrobial agent.
US11939289B2
The selective dimerization of isoolefins, such as isobutene or isopentane, or mixtures thereof, may be conducted in a system including a series of fixed bed reactors and a catalytic distillation reactor. The system may provide for conveyance of the fixed bed reactor effluents, without componential separation, to a downstream reactor. It has been found that a high selectivity to the dimer may be achieved even though intermediate separation of the desired product from unreacted components between reactors is not performed. Further, embodiments provide for use of a divided wall column for recovery of a high purity dimer product, reducing unit piece count and plot size.
US11939287B2
The present disclosure provides methods and processes for the recovery of compounds (e.g., pendant groups) from polymeric materials, as well as methods for recycling and reusing such compounds by synthetically converting a recovered compound to building blocks that can be used in, e.g., curable resins for the fabrication of new devices, such as medical devices (e.g., orthodontic appliances).
US11939285B2
This invention relates to novel derivatives of 4-hydroxybutyric acid and prodrugs thereof, and pharmaceutically acceptable salts of the foregoing. This invention also provides pharmaceutical compositions comprising a compound of this invention and the use of such compositions in methods of treating narcolepsy, fibromyalgia, other disorders or conditions that are beneficially treated by improving nocturnal sleep or by administering sodium oxybate.
US11939277B2
The invention provides a continuous preparation method of 2,3,3,3-tetrafluoropropene, comprising the following steps: carrying out liquid-phase catalytic telomerization reaction on ethylene and carbon tetrachloride serving as initial raw materials in the presence of a composite catalyst to obtain a reaction product; performing two-stage membrane separation and purification on the reaction product, and then sequentially performing a primary high-temperature cracking reaction, a gas-phase chlorination reaction, a secondary high-temperature cracking reaction, a primary gas-phase catalytic fluorination reaction and a secondary gas-phase catalytic fluorination reaction to obtain a reaction product; condensing and rectifying the secondary gas-phase catalytic fluorination reaction product to obtain the 2,3,3,3-tetrafluoropropene product.
US11939273B2
A limestone calcined clay cement construction composition comprises a) a cementitious binder comprising one or more calcium silicate mineral phases and one or more calcium aluminate mineral phases, and having a Blaine surface area of at least 3800 cm2/g; b) a supplementary cementitious material having a Dv90 of less than 200 μm comprising (b-1) a calcined clay material and (b-2) a carbonate rock powder in a weight ratio of (b-1) to (b-2) in the range of 0.5 to 2; c) optionally, an extraneous aluminate source; d) a sulfate source; and e) a polyol. The composition contains a controlled amount of available aluminate, calculated as Al(OH)4−, from the calcium aluminate mineral phases plus the optional extraneous aluminate source; and the molar ratio of total available aluminate to sulfate is 0.4 to 2.0. The construction composition further comprises f) an ettringite formation controller. The limestone calcined clay cement construction composition is a reduced carbon footprint composition and exhibits high early strength, high final strength, sufficient open time and high durability.
US11939268B2
A method of forming low-k material is provided. The method includes providing a plurality of core-shell particles. The core of the core-shell particles has a first ceramic with a low melting point. The shell of the core-shell particles has a second ceramic with a low melting point and a low dielectric constant. The core-shell particles are sintered and molded to form a low-k material. The shell of the core-shell particles is connected to form a network structure of a microcrystal phase.
US11939267B2
A method and apparatus for producing AlN whiskers includes reduced incorporation of metal particles, an AlN whisker body, AlN whiskers, a resin molded body, and a method for producing the resin molded body. The method for producing AlN whiskers includes heating an Al-containing material in a material accommodation unit to thereby generate Al gas; and introducing the Al gas into a reaction chamber through a communication portion while introducing nitrogen gas into the reaction chamber through a gas inlet port, to thereby grow AlN whiskers on the surface of an Al2O3 substrate placed in the reaction chamber.
US11939264B1
The present disclosure provides a preparation method for hydrothermal synthesis of fly ash silicate aggregate including: mixing sodium metasilicate, potassium hydroxide, and inorganic-organic hybrid excitation monomer as raw materials to obtain an inorganic-organic composite activator; preparing a silicate aggregate raw material, mixing measured fly ash, carbide slag, quicklime, and vitrified micro bubble by mass, adding the inorganic-organic composite activator and continue stirring to produce a mixture; forming a ball disc, wetting an expanded perlite that forms a core of the ball by spraying water, adding a prepared mixture, spraying water while adding, standing and curing, performing a maturation and activation treatment in an autoclave, undergoing a silicon calcium reaction for a hydrothermal synthesis to obtain the silicate aggregates. The present disclosure obtains silicate aggregates with high-performance by accelerating an internal activity of fly ash at an early stage and fully activating the activity of fly ash in all process.
US11939252B2
Mobile water filtration enables on-site recycling of wastewater for reuse in mechanical decoking operations of fired-heaters, furnaces, boilers, or systems prone to build up of deposits, residue, or scale and enables on-site disposal of wastewater in a safe and environmentally conscious manner. In batch operations, a coagulant, a flocculant, and a plurality of cascaded filters of increasingly fine pitch may be used to treat wastewater and remove particulate matter, such as, for example, coke, for reuse or safe disposal. In continuous operations, a plurality of cascaded filters of increasingly fine pitch may be used. A control system may be used to automate the operation of a mobile water filtration system for use with a decoking system, such that it does not require human intervention exception for maintenance operations related to filters. The filtered water may be disposed of on-site, eliminating the need for further treatment or transport off site.
US11939251B2
A peritoneal dialysis system includes a cycler including a pump actuator, a heater and a heating pan operable with the heater, and a disposable set operable with the cycler. The heating pan includes a sidewall forming a slot. The disposable set includes a pumping cassette and a heater/mixing container. The pumping cassette includes a pump chamber configured to be actuated by the pump actuator. Additionally, the heater/mixing container is in fluid communication with the pumping cassette and is sized to be received at the heating pan. The heater/mixing container includes a port configured such that when the port is slid into the slot of the heater pan sidewall, the port is prevented from rotating about an axis transverse to a direction of flow through the port.
US11939248B2
A system and method using a subterranean biological reactor can include a pre-reactor storage unit configured to receive a feedstock including a slurry of biologically derived material and at least one pump configured to pump the effluent from the pre-reactor storage unit. The system may include at least one wellbore containing a subterranean biological reactor configured to receive the effluent from the pre-reactor storage unit. At least a portion of the subterranean biological reactor may be configured to perform anaerobic digestion upon the effluent to generate a biogas.
US11939243B1
Water purification occurs under the influence of cold plasma obtained in water, which has a two-phase state, in which water and the smallest bubbles filled with gases dissolved in water are simultaneously present in the turbulence zone. The plasma is ignited inside the gas bubbles when exposed to an electric high-voltage nanosecond pulse. Since the turbulence zone located behind the flow body is saturated-saturated with fine bubbles, the plasma discharge in the bubbles becomes voluminous and diffuse in consistency. The combination of the hydrodynamic effect on water by the flow body and the generation of reactive oxygen species (ROS) in a volumetric plasma discharge in the turbulence zone causes a synergistic effect that increases the efficiency of water treatment.
US11939223B2
A process for the hydrophobization of a porous silica based compound involves the steps of providing a composition (I) containing a porous silica based compound, treating the composition (I) with a composition (II) containing hexamethyldisiloxane or its hydrolyzed form, and removing the treated silica based compound. The porous silica based compound obtained by the process is useful. A porous silica based compound obtained or obtainable by the process can be used for medical and pharmaceutical applications, as adsorbents, for cosmetic applications, as an additive for food, as a catalyst support, for the preparation of sensors, or for thermal insulation.
US11939222B2
A nanodiamond particle dispersion including nanodiamond particles highly dispersed in an organic solvent is provided. A nanodiamond particle dispersion of the present invention includes nanodiamond particles dispersed in an organic solvent, in which the nanodiamond particles have a silane compound (excluding a silane compound having a (meth)acryloyl group) bonded to a surface of the nanodiamond particles, the organic solvent has an SP value from 8.0 to 14.0 (cal/cm3)1/2, and the nanodiamond particles are dispersed with a particle diameter (D50) from 2 to 100 nm. The organic solvent is preferably at least one type of organic solvent selected from ketones, ethers, alcohols, and carbonates.
US11939216B2
A method includes producing a semiconductor wafer. The semiconductor wafer includes a plurality of microelectromechanical system (MEMS) semiconductor chips, wherein the MEMS semiconductor chips have MEMS structures arranged at a first main surface of the semiconductor wafer, a first semiconductor material layer arranged at the first main surface, and a second semiconductor material layer arranged under the first semiconductor material layer, wherein a doping of the first semiconductor material layer is greater than a doping of the second semiconductor material layer. The method further includes removing the first semiconductor material layer in a region between adjacent MEMS semiconductor chips. The method further includes applying a stealth dicing process from the first main surface of the semiconductor wafer and between the adjacent MEMS semiconductor chips.
US11939212B2
A MEMS device is provided. The MEMS device includes a substrate having at least one contact, a first dielectric layer disposed on the substrate, at least one metal layer disposed on the first dielectric layer, a second dielectric layer disposed on the first dielectric layer and the metal layer and having a recess structure, and a structure layer disposed on the second dielectric layer and having an opening. The opening is disposed on and corresponds to the recess structure, and the cross-sectional area at the bottom of the opening is smaller than the cross-sectional area at the top of the recess structure. The MEMS device also includes a sealing layer, and at least a portion of the sealing layer is disposed in the opening and the recess structure. The second dielectric layer, the structure layer, and the sealing layer define a chamber.
US11939209B2
A metering pump for dispensing a fuel additive includes a pump body, an inlet and an outlet at which fuel additive respectively enters and exits the metering pump, a piston contained within a piston bore and being configured to draw fuel additive into the metering pump through the inlet and to dispense fuel additive from the metering pump through the outlet, an inflow valve configured to permit fuel additive to flow in a single direction away from the inlet and to prevent fuel additive from flowing in an opposite direction back into the inlet, and an outflow valve configured to permit fuel additive to flow in the single direction towards the outlet, wherein the metering pump has a configuration in which the inlet, the outlet, the piston, the piston bore, the inflow valve, and the outflow valve are centrally positioned along a central plane of the pump body.
US11939208B2
A liquid is efficiently suctioned and discharged from and to a container formed by a plurality of aligned storing portions for storing the liquid, using a plurality of nozzles. Provided is a liquid suction/discharge device including a container support device for supporting a culture container formed by a plurality of aligned storing portions, and a nozzle support device for supporting a plurality of nozzles in a state in which distal ends of the nozzles are directed downward. The nozzle support device includes a nozzle support member that swingably supports the plurality of nozzles using prescribed parts as support points, and the liquid suction/discharge device further includes a nozzle inclination device for causing each of the nozzles to be inclined with respect to the nozzle support member.
US11939204B2
A juice dispenser, including a first tank including a first inlet, a first outlet, and a first faucet for the first outlet, and a second tank surrounding first tank, and including a second inlet, a second outlet, and a second faucet for the second outlet, thereby the second tank is not heat insulated, and the second tank insulates the first tank and thereby after inserting heated water into the tanks, adjustable opening of the first and second faucets dispenses the water to a receptacle mixed at an adjustable temperature.
US11939198B2
In a transporting system for transporting a container, and a method for operating a production installation having a transporting system, the transporting system has a vehicle and a transport vehicle, on whose frame two wheel drives are disposed, which are set apart from each other and have a wheel in each case, in particular, the two wheels are disposed so as to touch a floor in order to generate traction force for the transport vehicle, in particular, the wheel axles of the two wheels are aligned parallel to each other. A first and a second shoulder part are situated and/or provided on the frame, and the first shoulder part is situated at a distance from the second shoulder part, and a space region is situated between the wheel drives and between the shoulder parts, into which the vehicle together with the container it accommodates is able to be driven and out of which the vehicle together with the container may be driven. The container has a width that is greater than the distance, in particular the smallest distance, between the shoulder parts, the vehicle has a lifting device, and the vehicle is able to be driven into the space region when the lifting device is lowered and also when it is raised. When the lifting device is raised, the container is able to be positioned above the shoulder parts on the vehicle, and when the lifting device is lowered, the container may be positioned so as to sit on the shoulder parts.
US11939196B1
An apparatus for lifting and lowering manhole covers is shown and described. The apparatus for lifting and lowering manhole covers includes a main beam secured to a vehicle connection support. A winch is secured along the main beam. The winch is configured to secure to a manhole cover. A support leg secured to the main beam such that the winch is positioned between the vehicle connection support and the support leg.
US11939181B1
A sheet post-processing apparatus including a binding mechanism, a tray, a shift mechanism, and a control unit is provided. The binding mechanism is configured to apply binding to a sheet. The sheet applied with the binding is stacked on the tray. The shift mechanism is configured to perform a shift operation in which a side surface of the sheet is pushed and the sheet is deviated in a sheet width direction orthogonal to a discharge direction during discharge of the sheet to the tray. The control unit is configured to cause the shift operation to be performed by dividing the number of times for the shift operation into a plurality of times.
US11939178B2
A device for neatly winding up cargo ties includes a moveable clamp arm a first end of which projects out of an opening of the housing such that the clamp arm and the housing together form a pair of jaws that can selectively be placed about a variety of surfaces and tightened. The jaws are loosened and tightened through the rotation of a threaded rod that engages with a second end of the clamp arm at the interior of the housing causing movement of the clamp arm along a clamping axis. In some embodiments, a nut which is prevented from rotating, is disposed at the second end of the clamp arm and comprises threading that engages with the threading on the threaded rod moving the clamp arm along the clamping axis.
US11939177B2
An image forming apparatus includes a sheet accommodating portion, an image forming portion, an accommodating portion opening portion, a lifter plate, a lifter plate lifting and lowering mechanism, a lower-limit detecting portion, a control unit lowering the lifter plate and opening the accommodating portion in accordance with an operation in a set mode of a plurality of modes when the control unit receives an instruction to open the accommodating portion, wherein the modes includes a first mode in which the accommodating portion is opened irrespective of whether or not the lifter plate lowers to the lower-limit position and a second mode in which the accommodating portion is opened after the lifter plate lowers to the lower-limit position; and an operating portion operable by an operator for changing setting of the mode, between the modes, executed when the control unit receives the instruction to open the accommodating portion.
US11939173B2
A transportation head for a microchip transfer device capable of minimizing mechanical and chemical damage to a microchip, a microchip transfer device having same, and a transfer method thereby, and the transportation head includes a head body having a pickup area and a dummy area; a first protruding pin disposed in the pickup area of the head body; and a liquid droplet attached to the first protruding pin.
US11939170B2
Devices, methods, and computer program products for article retrieval are provided. An example article retrieval device includes a frame and a pair of loading arms movably attached to the frame that move between a retracted position and an extended position. The device includes an engagement structure movably attached to at least one of the pair of loading arms that moves between a stored position and a deployed position. The device further includes a sensing device coupled with the pair of loading arms and a computing device operably coupled with the pair of loading arms, the at least one engagement structure, and the sensing device. The computing device causes the pair of loading arms to extend from the retracted position to a position proximate a first article and deploys the at least one engagement structure based upon sensor data generated by the sensing device.
US11939160B2
An article transport vehicle (3) includes: a travel unit (11) that travels to a set position (P1) that has been set so as to correspond to each of a plurality of storage units (1) configured to store an article (W); a support portion (12) configured to support the article (W); a lighting unit (13) that emits light; and a control unit that controls the travel unit (11) and the lighting unit (13). The control unit executes a travel control that controls the travel unit (11) such that the travel unit (11) travels to the set position (P1) that has been set so as to correspond to a target storage unit (1A), and a lighting control that controls the lighting unit (13) so as to emit light to a lighting position (P2) that corresponds to the target storage unit (1A).
US11939158B2
A storage and retrieval system including a vertical array of storage levels, each storage level having, picking aisles, storage locations, disposed within the picking aisles, and at least one transfer deck providing access to the picking aisles, a multilevel vertical conveyor system configured to transport the uncontained case units to and from the vertical array of storage levels, each storage level being configured to receive uncontained case units from the multilevel vertical conveyor system, at least one autonomous transport located on each storage level for transporting the uncontained case units between respective storage locations and the multilevel vertical conveyor system, and a controller configured to create a primary access path through the transfer decks and picking aisles to a predetermined one of the storage locations and at least one secondary access path to the predetermined one of the storage locations when the primary path is impassable.
US11939157B2
A robotic service device is described for use on a robotic picking system grid. The robotic service device is capable of driving to any location on the grid order to perform maintenance operations or cleaning. Additionally, the service device may be used to rescue robotic load handling devices operational in the picking system. The robotic service device may include a releasable docking mechanism to enable it to dock and latch on to malfunctioning load handling devices. The service device may also be provided with cleaning capability and a camera to enable the condition of the grid and other robotic devices to be monitored.
US11939155B2
A refuse container tipping device includes a first mounting plate, a second mounting plate, a hinge plate, and a plurality of fasteners. The first mounting plate defines a plurality of first slots. The plurality of first slots each extend in a first direction along substantially parallel axes. The second mounting plate is releasably coupled to the first mounting plate and defines a plurality of second slots. The plurality of second slots each extend in a second direction along substantially parallel axes. The first direction is perpendicular to the second direction. The hinge plate is coupled to the second mounting plate. The hinge plate supports a hinge and a grapple arm that is rotatably coupled to the hinge. The plurality of fasteners couple the second mounting plate to the first mounting plate by extending through the plurality of first slots and the plurality of second slots.
US11939153B2
A refuse container lid opening device includes a lid hingedly attached to a container body for covering the container body's top opening. The lid is free of grabbable handles or protuberances but an elongated tongue descending from its underside is received in a slot in the top rim of the container body and is accessible outward of the container body. Upward movement of the tongue when the lid is closed raises the lid above the top rim of the container body to form a manually accessible gap in which a hand can be inserted to fully open the lid.
US11939151B1
A dunnage assembly has a plurality of dunnage sections removably attached to each other and includes a forwardmost dunnage section and an aftmost dunnage section. The forwardmost dunnage section has the longest length and the aftmost dunnage section has the shortest length. Each dunnage section has a plurality of tubes and a plurality of tube collars that support the tubes such that the tubes are substantially parallel to each other. Each tube of each dunnage section has an interior region sized to receive a longitudinally extending item and is substantially coaxially aligned with a tube of an adjacent dunnage section. Each tube collar has a plurality of thru-holes therein where each thru-hole is sized to receive a portion of a tube. Each dunnage section includes a tube collar removably attached to a tube collar of an adjacent dunnage section.
US11939149B2
The present disclosure provides an industrial container and a method of opening an industrial container. The industrial container includes a container body, a pivot assembly, a counter-balancing spring assembly, and a locking assembly. The container body can have a plurality of walls, the plurality of walls including a pivotable ramp wall. The pivot assembly can connect the ramp wall with the container body for pivotal movement of the ramp wall, and the pivot assembly can include a pivot shaft supported by a pair of arms. The counter-balancing spring assembly can include one or more springs arranged about the pivot shaft for biasing the ramp wall from a downwardly inclined loading position upwardly toward a vertical closed position with a torque force. The locking assembly can be configured to lock the ramp wall in the vertical closed position.
US11939146B2
Embodiments of the present disclosure are directed to multilayer silo bags that may include a tube comprising at least two layers, a first open end, a second open end, and a first region and a second region disposed between the first and second end. One or more of the at least three layers may comprise an ethylene/alpha-olefin interpolymer having a density of 0.90 g/cc to 0.965 g/cc and an I2 of 0.1 to 6.0 g/10 minutes, a low density ethylene-based polymer having a density of 0.917 g/cc to 0.935 g/cc and an I2 of 0.1 to 2.0 g/10 minutes, or combinations thereof. The first region may have a thickness of at least 10% greater than a thickness of the second region. The first region may have a surface area that is at least 50% of an overall surface area of the multilayer silo bag.
US11939134B2
A packaging filler insert includes a first packaging filler insert end and a second packaging filler insert end. A first packaging filler insert side extends from the first packaging filler insert end to the second packaging filler insert end and a second packaging filler side extends from the first packaging filler insert end to the second packaging filler insert end. An outer packaging filler insert face has at least one tab, and an inner packaging filler insert face located and positioned opposite from the outer packaging filler face. A pair of filler inserts are positioned between upper and lower portions of an item that is shipped in a carton, to provide support for the upper portion, such as via engagement with corner posts positioned between the filler inserts and adjacent corners of the carton.
US11939130B2
The present disclosure may provide a package assembly for packaging an object. The package assembly may include a bottom panel, at least one group of side panels, a left panel, a right panel, and at least one fastener. The at least one fastener may correspond to the at least one group of side panels respectively. For each of the at least one fastener, the fastener may be fixedly connected to a portion of a corresponding group of side panels. The portion of the group of side panels can be folded inwardly to make the fastener contact with an object placed on the bottom panel. The left side panel and the right side panel can be folded outwardly to fasten the fastener such that the object is fixed on the bottom panel.
US11939128B2
Aspects of the disclosure relate to a package, a carton (190), and a blank (110) for forming the carton. An aspect of the invention provides a carton comprising a plurality of primary panels (112, 114, 116, 118, 120) defining an interior of the carton. The carton comprises a first panel (118) and a second panel (120) hinged to the first panel along a first fold line (119). The first panel has a first corner edge (55a) extending obliquely with respect to the first fold line such that an obtuse angle is defined between the first corner edge and the first fold line. The carton further comprises an opening feature (D) which is at least partially removable from the carton. The opening feature comprises a removable panel (170a) defined at least in part by first (173a) and second tear lines (173b) which define opposing side edges of the removable panel respectively.
US11939120B2
A collapsible and self-erecting polyhedron system is provided. The system includes a collapsible and self-erecting box. The box comprises cardboard and includes outer surfaces upon which images (e.g., photographic reproductions), graphics, and text are printed to provide a three-dimensional greeting card. The three-dimensional greeting card (the box) is collapsed and placed into an envelope, and upon being removed from the envelope, automatically self-erects providing a fun and exciting experience. Confetti also is included within the box that is ejected during the box self-erecting, thereby providing even more enjoyment.
US11939117B2
A sump pump crock includes a body including a first portion and a second portion separate from the first portion. The first portion includes one of a tab and an opening, and the second portion includes the other of the tab and the opening. The tab is received in the opening to secure the first portion to the second portion. The body defines a base, a plurality of sidewalls, and a top opening, and a plurality of flanges extend around an outer perimeter of the body. The sump pump crock includes a removeable lid that covers the top opening.
US11939112B2
A tray composite comprises a polymeric based liner including an exterior surface layer, an interior surface layer, and a formed base removably affixed to the interior surface layer of the polymeric based liner. A formed base is removably affixed to the interior surface layer of the polymeric based liner. The polymeric based liner and the formed base are manually separable after they have been removably affixed together by a first portion of the interior surface layer remaining affixed to the formed base and a second portion of the interior surface layer separating from the first portion of the interior surface layer.
US11939110B2
A stackable container lid includes a top surface defining a flat surface plane without an upward protrusion, at least one recess in the top surface, a bottom surface including a rib structure adjacent a perimeter, and at least one nest segment integrated with the rib structure and protruding from the rib structure. The container lid is readily stackable with other container lids and is suited for handling with automation equipment.
US11939109B2
A shock-absorbing structure includes an underlay placed on a base, and a cushioning member disposed on the underlay. The underlay includes at least one positioning portion that includes a slope raised in a position inclined with respect to another area of the positioning portion and fixes the cushioning member in position, and a support portion that supports the slope in an obliquely raised position. The cushioning member includes at least one hollow that receives the positioning portion.
US11939103B2
The present disclosure relates to a label-placement module having a first feeder assembly, including a horizontal delivery platter for receiving a label, and a first drive wheel, positioned adjacent to a distal end of the horizontal delivery platter and rotatable to move the label on the horizontal delivery platter in a first direction. The label-placement module may include a second feeder assembly coupled to an actuator that moves the second feeder assembly vertically to a delivery position associated with the container. The second feeder assembly having a vertical delivery platter for receiving the label from the horizontal delivery platter and a second drive wheel rotatable to move the label forward in the first direction towards the container such that at least a portion of the label may be clamped between the container and a lid of the container thereby attaching the label to the container.
US11939102B2
A lifting apparatus for a case on a conveyor system. A chain vertically hangs over a conveyor belt. A hook is positioned on an end of the chain. A piston retracts and releases the chain. The hook interacts with and moves front flaps on cases traveling on the conveyor system.
US11939096B2
Provided is a bag gripping clip, in which, in a case where a bag that forms an accommodation space between a first film and a second film facing the first film is gripped by the clip, a pressing force for bringing the first film and the second film into partially close contact with each other is applied to the bag, and a partition that divides the accommodation space into a plurality of spaces communicating with each other via a communication part is formed.
US11939095B2
System for heat shrink sealing open-topped containers wherein the system includes a housing or enclosure wherein a majority of a bulk roll of film material is accessible when the cover is open. The system preferably includes two opposing rollers that are configured to engage the film and cause it to move to a dispensing position. In a preferred aspect, the system includes a movable sealing unit that accommodates use of the lidding system with open ended containers having various sizes and shapes. In a more preferred aspect, the system includes an indicia generating device operable to label sealed containers and a knife that generates a perforation in the film during sealing operations.
US11939089B1
A method for securing a palletized load is provided. The method comprises dispensing a first stretch film vertically inserted over a first support member, dispensing a second stretch film having an upper lateral side edge and a lower lateral side edge and being vertically inserted over a second support member, edging at least one of the upper lateral side edge and the lower lateral side edge of the second stretch film to obtain an edged second stretch film, partially overlapping the edged second stretch film and the first stretch film, passing the combined stretch film through a pre-stretcher, and wrapping the combined stretch film around the palletized load. The height of the stretch film can be adjusted using a height adjustment device. A third stretch film can be dispensed and combined with the first and second stretch films.
US11939082B1
The invention discloses a system for reducing ambient noise generated from an acoustic domain, comprising a landing pad comprising a plurality of zones of varied porosity levels over specified sections, and a plurality of perforated channels across the plurality of zones of varied porosity levels, the perforated channels comprising a plurality of aqueous sheets placed at an inlet of the perforated channels and along the perforated channels. Also disclosed is a method of reducing ambient acoustic noise produced by unmanned aerial vehicle (UAV) operations, the method comprising the steps of absorbing acoustic energy produced by the UAV via a plurality of zones of varied porosity levels, present in a UAV landing pad, resulting in reducing sound-pressure transmission-loss of propeller downwash across the plurality of zones of varied porosity.
US11939078B1
Fuel used as a coolant in an aircraft can be thermally conditioned for active thermal management of the airframe and engine. The fuel can be thermally conditioned using the residual cooling capacity of a power and thermal module (PTM), providing flexibility of thermal system design, or via a compact engine-mounted turbo cooler, to maximize system efficiency. The fuel can be stored in a thermal reserve tank to provide a missionized heat sink capable serviceable for periodic high heat flux equipment. The cooling and provision of cooled fuel to aircraft components can be intelligently controlled to provide efficient cooling and effectively unlimited ground hold times.
US11939075B2
Systems and methods are configured for power distribution in a hybrid fixed-wing VTOL drone aircraft. A drone aircraft includes two modes of operation. In a first mode of operation, the internal combustion engine is shut off while an electric motor-based VTOL system provides lift and thrust. In a second mode of operation, an internal combustion engine provides thrust while a set of fixed wings provide lift. In the second mode of operation, mechanical power from the internal combustion engine provides for power generation to charge an electrical battery to power the electric motor-based VTOL system.
US11939064B2
A reclining seat including, but not limited to, a seat bottom; a seat back, a leg support, and an arm support forming a seat assembly. The seat assembly is configured to be supported on a floor surface and to move between an upright configuration and a flat configuration. The seat back and the leg support are transverse to the seat bottom, and the arm support is transverse to the seat back, when the seat assembly is in the upright configuration. The seat back, the seat bottom, the leg support and the arm support are each longitudinally aligned with one another when the seat assembly is in the flat configuration. An upper surface of the seat back, the seat bottom, and the leg support are each coplanar with one another and substantially coplanar with the arm support when the seat assembly is in the flat configuration.
US11939062B2
Provided is an Aircraft Lavatory Unit 20 that ensures lavatory user comfort while facilitating diaper changing. The Aircraft Lavatory Unit 20 includes a Diaper Changing Table 10 on which an infant can be placed and which can be selectively changed between a Housed State in which the Diaper Changing Table 10 is housed in a Wall Surface and a Pulled-Out State in which the Diaper Changing Table 10 is pulled out from the Wall Surface; and a display 25 which is disposed to face the Diaper Changing Table 10 in the Pulled-Out State and display still images or videos.
US11939043B2
Systems and methods for mechanically rotating an aircraft about its center-of-gravity (CG) are disclosed. The system can enable the rear, or main, landing gear to squat, while the nose landing gear raises to generate a positive angle of attack for the aircraft for takeoff or landing. The system can also enable the nose gear and main gear to return to a relatively level fuselage attitude for ground operations. The system can include one or more hydraulically linked hydraulic cylinders to control the overall height of the nose gear and the main gear. Because the hydraulic cylinders are linked, a change on the length of the nose cylinder generates a proportional, and opposite, change in the length of the main cylinder, and vice-versa. A method and control system for monitoring and controlling the relative positions of the nose gear and main gear is also disclosed.
US11939041B2
A method for controlling an aircraft, in particular a VTOL multirotor aircraft, in which flight influencing units of the aircraft a) are supplied with control commands via a first/control channel from a first computer (COM), which control commands originate or are derived from a pilot input (PE), and b) the control commands are monitored by a second/monitoring channel and a second computer (MON), which checks whether the control commands are suitable for a given physical state of the aircraft and the pilot input, c) the second computer determines whether a current navigation state of the aircraft coincides with the pilot input, which has been transformed into a desired navigation state of the aircraft, preferably by the second computer, within a prescribed deviation, and d) a control signal for controlling the aircraft is generated in dependence on a determination result of step c).
US11939028B2
A bicycle component controller is basically provided with a processor. The processor is configured to perform a gear shift control based on a sprocket assembly information of at least one sprocket assembly. The sprocket assembly information at least includes a single shifting distance and shifting gate information. The single shifting distance corresponds to an axial spacing between adjacent sprockets of the at least one sprocket assembly.
US11939025B2
A straddle type vehicle comprises a steering mechanism configured to steer a front wheel a steering damper device capable of variably generating a damping force working on a rotating action of the steering mechanism; and a control unit configured to control the damping force of the steering damper device to increase, when the front wheel of the straddle type vehicle in a wheelie state lands on a ground. The control unit controls the damping force to increase, after the front wheel lands on the ground and an oscillation occurs in the steering mechanism.
US11939023B2
A micromobility electric vehicle includes a front storage volume and a rear storage volume. The front storage volume may be defined on two sides by an angled footboard portion and a column. The rear storage volume may be defined on two sides by a curved footboard portion and a seat post. Retainers including an elastic member may be employed in the front and/or rear storage volume to releasably secure objects of different sizes and shapes in the front or rear storage volumes. Hooks may be employed in the front and/or rear storage volumes to allow an object with a strap to be supported in the front or rear storage volume.
US11939019B2
An electric kickboard may include: a top plate of a foot plate including a receiving portion in which an electronic lock device for fixing the electric kickboard is installed; and a bottom plate of the foot plate, which is assembled to the top plate of the foot plate and fixes the electronic lock device.
US11939017B2
A suspension is provided for coupling a front wheel with a chassis of an off-road vehicle. The suspension comprises upper and lower suspension arms that each includes two inboard mounting points to the chassis and one outboard rod-end joint to a spindle assembly coupled with the front wheel. A ball comprising each outboard rod-end joint is fastened by way a bolt between a pair of parallel prongs extending from the spindle assembly. The upper suspension arm is configured to facilitate coupling a strut between the lower suspension arm and the chassis. A steering rod is coupled with the spindle assembly by way of a steering rod-end joint that is disposed forward of a drive axle, thereby decreasing leverage of the front wheel on the steering rod and substantially eliminating bump steer that may occur due to rough terrain.
US11939014B2
A system for adjusting steering damping based on sound frequency analysis includes: an acoustic main body configured to play music and determine whether the music is being played; a sound collection device configured to collect a sound signal of the music being played; a sound frequency analysis device configured to receive the sound signal of the music collected by the sound collection device and determine whether the collected music has a strong beat; and a power steering electronic control unit electrically connected to the sound frequency analysis device and configured to receive a determination result of the sound frequency analysis device and adjust the steering damping according to the received determination result of the sound frequency analysis device.
US11938996B2
A steering column assembly includes a lower jacket. The steering column assembly also includes an upper jacket operatively coupled to the lower jacket, the upper jacket telescopingly moveable relative to the lower jacket. The steering column assembly further includes a rake bracket operatively coupled to the lower jacket. The steering column assembly yet further includes an energy absorption strap operatively coupled to the upper jacket, at least a portion of the energy absorption strap disposed radially outward of the rake bracket.
US11938994B2
A stroller includes a stroller frame, a reversible member pivoted to the stroller frame, and a reversible mechanism. The reversible mechanism locks the reversible member at different positions and includes a sliding sleeve, a release actuator movably disposed on the reversible member and linked with the sliding sleeve, and anchoring portions disposed on at least two different positions. The sliding sleeve movably jackets the reversible member and is selectively engaged with any anchoring portion. The sliding sleeve moves together with the release actuator or is directly operated for releasing the anchoring portion, so as to make the reversible member rotatable to another position. Since the release actuator is linked with the sliding sleeve, the release actuator can be disposed at a position easy to operate, so that the handle reversing operation can be performed conveniently and quickly. Furthermore, the reversible mechanism has a simple structural design.
US11938993B2
A pull strap (100) and a child supporter (200) having same; a frame (201) is provided thereon with a folding mechanism (203) that facilitates the folding of the frame; the pull strap is used for folding the frame of the child supporter; and the pull strap comprises a non-elastic belt (10) and an elastic belt (20) which are linkedly provided; an end portion of the non-elastic belt is connected to the folding mechanism, or end portions of the non-elastic belt and the elastic belt are connected to the folding mechanism; the pull strap is operated to deform the elastic belt, so that the non-elastic belt drives the folding mechanism to act, thereby causing the frame to fold. The pull strap and the child supporter provided with the pull strap are simple in structure and convenient to operate; in addition, manufacturing costs are effectively reduced.
US11938990B1
This disclosure describes, in part, a mobile apparatus for identifying items. For instance, the mobile apparatus may include a frame, a basket that attaches to the frame, a tray that attaches to the frame, and a user-facing module that attaches to the frame. Weight sensors may be located beneath the basket and the tray in order to determine the weights of items added to the mobile apparatus. The user-facing module may include imaging devices, such as cameras, that the mobile apparatus uses to perform one or more functions. For example, the mobile apparatus may use the imaging devices to identify items placed within the basket, determine locations of the mobile apparatus within a facility, and/or the like. By including these components, the mobile apparatus is able to generate data that represents the items added to the mobile apparatus, the weights of the items, and the costs of the items.
US11938985B2
A highway grade crossing gate mechanism having a smart cam system capable of measuring a parameter of the gate mechanism in real time is provided. The gate mechanism includes a DC motor, a cam system, and a controller. The DC motor is coupled to a main shaft for driving a gate arm between a vertical position and a vertical position. The cam system includes manually adjustable cams coupled to the main shaft that move contacts to open or close at some preset angular rotation in order to set operational features of a crossing gate. An internal sensing device is disposed internal to the cam system measuring a parameter of the gate mechanism in real time. A controller controls the motor and receives and stores the parameter. The parameter may be transmitted to an external network giving accurate feedback of the state of the gate mechanism in real time.
US11938984B2
The present invention relates to a multi-layer coupling relationship-based train operation deviation propagation condition recognition method, where the method includes the following steps: (1) recognizing an effective train event time sequence, including an arrival event and a departure event of a train at each passing station; (2) uniformly extracting train activity data, including a stop activity, a section operation activity, a turn-back activity, and an arrival or departure interval activity; (3) constructing coupling relationship groups between a train event and a train activity and between train activities; and (4) performing statistics on changes of train operation deviation in each relationship group, and outputting a respective distribution function and a time-space distribution visualized result. Compared with the prior art, the present invention has the advantages of being practical, automatic recognition, feedback optimization, and the like.
US11938980B2
A RIO device mounted to a train includes an output unit that outputs a signal to a relay mounted to the train, and a controller that controls whether or not to cause the output unit to output the signal. The output unit includes a readback circuit that detects whether or not the signal is outputted from the output unit. The controller makes a signal stop request and a signal output request to the output unit before operation of the train starts, acquires a detection result of the readback circuit while each of the signal stop request and the signal output request is performed, and detects abnormality of the output unit using the detection result.
US11938978B2
A grade crossing control system includes a track circuit with a grade crossing predictor (GCP) system coupled to rails of a railroad track at a grade crossing, wherein a railroad vehicle travelling on the railroad track causes a change of impedance when entering the track circuit, and wherein the GCP system generates grade crossing activation signals in response to the change of the impedance of the track circuit, wherein, for detecting the change of impedance, the GCP system includes a first transmitter transmitting a first signal over the track circuit and a first receiver detecting a first response signal, a second transmitter transmitting a second signal over the track circuit and a second receiver detecting a second response signal, wherein the first transmitter and the first receiver are preprogrammed to a first frequency, and wherein the second transmitter and the second receiver are preprogrammed to a second frequency.
US11938967B2
The technology relates to maneuvering a vehicle prior to making a turn from a current lane of the vehicle. As an example, a route that includes making the turn from the lane is identified. An area of the lane prior to the turn having a lane width of at least a predetermined size is also identified. Sensor data identifying an object within the lane is received from a perception system of a vehicle. Characteristics of the object, including a location of the object relative to the vehicle, are identified from the sensor data. The vehicle is then maneuvered through the area prior to making the turn using the identified characteristics.
US11938964B2
A method for safely ascertaining infrastructure data for driving a motor vehicle in at least partially automated fashion. The method includes receiving data signals, which represent infrastructure sensor data generated by at least one infrastructure sensor and/or motor vehicle data generated by at least one source motor vehicle, receiving safety condition signals, which represent at least one safety condition for safely ascertaining infrastructure data based on the data, checking whether the at least one safety condition is fulfilled, ascertaining infrastructure data, on the basis of which it is possible to drive a destination motor vehicle in at least partially automated fashion, based on the data as a function of a result of the check as to whether the at least one safety condition is fulfilled, generating infrastructure data signals, which represent the ascertained infrastructure data, outputting the generated infrastructure data signals.
US11938963B1
A live map system may be used to propagate observations collected by autonomous vehicles operating in an environment to other autonomous vehicles and thereby supplement a digital map used in the control of the autonomous vehicles. In addition, a live map system in some instances may be used to propagate location-based teleassist triggers to autonomous vehicles operating within an environment. A location-based teleassist trigger may be generated, for example, in association with a teleassist session conducted between an autonomous vehicle and a remote teleassist system proximate a particular location, and may be used to automatically trigger a teleassist session for another autonomous vehicle proximate that location and/or to propagate a suggested action to that other autonomous vehicle.
US11938962B2
A server of a driving support system includes a path setting unit configured to set a first traveling path in which a vehicle travels in a parking lot, a detecting unit configured to detect a person, and a determining unit configured to determine whether or not a person is present in a part of the first traveling path, based on the detection result of the detecting unit. When it is determined that a person is present for a predetermined time or more in the part of the first traveling path, the path setting unit searches for a second traveling path that is a path that bypasses the part of the first traveling path, and the detecting unit limits the processing for the measurement result of the sensor whose measurement target is the part of the first traveling path after the second traveling path is searched.
US11938953B2
Among other things, we describe techniques for operation of a vehicle based on measured load characteristics and/or passenger comfort. One or more sensors of the vehicle can measure passenger data and/or load data of the vehicle. The passenger data and/or load data of the vehicle can be used by the vehicle to determine how to navigate within the surrounding environment.
US11938952B2
A traveling trajectory estimation system obtains traveling record information indicating a past traveling record of a vehicle, and characteristic object position information indicating the installation position of a characteristic object, and performs a vehicle position estimation process to estimate an object vehicle position at an object time, based on the traveling record information and the characteristic object position information. In the vehicle position estimation process, not only a time previous to the object time, but also a time subsequent to the object time, is used as a reference time. The traveling trajectory estimation system sets each of a plurality of successive times as the object time, and performs the vehicle position estimation process, to estimate the object vehicle positions at the respective times, and determines a collection of the estimated object vehicle positions as a traveling trajectory of the vehicle.
US11938947B2
A system for monitoring a fatigue level of an operator of a vehicle includes a sensor configured to generate a signal indicative of a physiological state of the operator; a display for the operator; and a controller to: receive, from the sensor, the signal; determine the fatigue level of the operator by analyzing the received signal using an algorithm developed using operator fatigue statistics; generate a real-time fatigue report for the operator based on the determined fatigue level of the operator; transmit the generated real-time fatigue report to the display for the operator for display to the operator, and a display for a dispatcher for the vehicle for display to the dispatcher; generate an anonymized version of the real-time fatigue report; and transmit the anonymized version of the real-time fatigue report to a cloud for access by remote users.
US11938941B2
Systems, methods, and other embodiments described herein relate to adaptively selecting a controller for generating vehicle controls. In one embodiment, a method includes, in response to acquiring sensor data about a surrounding environment of the vehicle, determining a driving context of the vehicle in relation to aspects of a roadway on which the vehicle is traveling. The method includes selecting a controller for generating control inputs to the vehicle according to the driving context by selecting between a proportional, integral, derivative (PID) controller and a machine learning (ML) controller. The method includes controlling the vehicle using the controller.
US11938929B2
A computer includes a processor and a memory, and the memory stores instructions executable by the processor to receive sensor data indicating an obstacle, formulate a first control barrier function for a vehicle based on the sensor data, formulate a second control barrier function for a trailer hitched to the vehicle based on the sensor data, determine a control input based on the first and second control barrier functions, and actuate a component of the vehicle according to the control input.
US11938923B1
A longitudinal and lateral vehicle motion cooperative control method based on a fast solving algorithm comprises the following steps: calculating a desired yaw rate according to a steering wheel rotation angle and a current vehicle traveling speed; constructing a nonlinear optimization problem according to the desired yaw rate and a current actual motion state of a vehicle, wherein an objective function of the nonlinear optimization problem is used for tracking the desired yaw rate, and simultaneously for restraining a lateral speed and a tire slip ratio of the vehicle; solving the nonlinear optimization problem to calculate desired slip ratios of four tires; calculating an additional torque of each tire according to an actual slip ratio and the desired slip ratio of the tire; and sending the additional torque of each tire to an actuator of the vehicle for cooperative control.
US11938921B2
A vehicle control device that controls a vehicle is configured to execute rotation speed control when the vehicle is in series traveling, in which a rotation speed of the internal combustion engine is increased to a first rotation speed in accordance with an increase in a speed of the vehicle, and when the rotation speed of the internal combustion engine reaches the first rotation speed, the rotation speed of the internal combustion engine is decreased to a second rotation speed lower than the first rotation speed; and restrict execution of the rotation speed control when receiving a predetermined operation.
US11938917B2
A braking control device for a vehicle includes a malfunction detector configured to detect a malfunction of a first stroke sensor or a second stroke sensor, a memory configured to store a first stroke and a second stroke, a stroke calculator for first calculation configured to calculate, from the first stroke and the second stroke, an average value for calculating a target deceleration before a malfunction is detected by the malfunction detector, a stroke calculator for second calculation configured to calculate, from the average value and the second stroke (first stroke), an additional value for calculating the target deceleration after the malfunction is detected, and a target deceleration setting circuit configured to set the target deceleration from the average value or the additional value.
US11938915B2
A braking arrangement for a vehicle includes a source of compressed air, a drive axle for the vehicle, a brake associated with the drive axle and connected to the source of compressed air by an air line, an operator controlled valve in the air line between the source of compressed air and the brake, a proportioning valve in the air line between the operator controlled valve and the brake. A compressor is driven by the drive axle or a drive shaft of the vehicle and has an outlet connected to a control port of the proportioning valve.
US11938910B2
A non-return valve device has at least part of a flow channel for a fluid and a movable cord-like sealing element arranged in the flow channel. The sealing element is configured such that it can be moved at least partially between a closed position and an open position, wherein, in the open position, a fluid flow is permitted through the flow channel, whereas in the closed position, the fluid flow through the flow channel is blocked by form-fitting engagement with the sealing element.
US11938909B2
A method of operating a vehicle comprising at least a first vehicle retarding subsystem controllable to retard the vehicle, and processing circuitry coupled to the at least first vehicle retarding subsystem, the method comprising the steps of: acquiring, by the processing circuitry from the first vehicle retarding subsystem, at least one value indicative of current energy accumulation by the first vehicle retarding subsystem; and determining, by the processing circuitry, a measure indicative of a retardation energy capacity currently available for retardation of the vehicle, based on: the acquired at least one value indicative of current energy accumulation by the first vehicle retarding subsystem; a predefined model of retardation energy accumulation by the first vehicle retarding subsystem; and a predefined limit indicative of a maximum allowed energy accumulation by the first vehicle retarding subsystem.
US11938908B2
The preferred embodiment of the present invention includes method for replacement of the slide block of a single arm automotive window lift regulator that was damaged due to normal wear-and-tear on the window regulator, or from stress placed on the slide block of the window regulator at the point where the slide block is attached to the window regulator arm. The invention applies to the window regulators installed in the w901, 902 and 903 series Mercedes Benz Sprinter and Dodge Sprinter vans, built between 1995 and 2006, Mercedes Benz Sprinter vans built between 1995-2002, Dodge Sprinter vans 2500, 3500 built between 2002 and 2006, Freightliner Sprinter vans 2500, 3500 built between 2002 and 2006. The method of the present invention provides a service kit that contains a replacement slide block of a different design and material, replacement mounting bolt of a specific design and a locking nut.
US11938903B1
A vehicle cargo lift includes a stationary slide adapted to be mounted on a roof of a vehicle. The cargo lift is automatically extended to a position for easily loading cargo onto the lift and is automatically retractable to a position on top of the vehicle roof. A rolling slide is slidably mounted to the stationary slide and a rear tray is movably supported by the rolling slide. A front tray is supported by the rear tray via a pair of elbow arm assemblies that are extendable below the rear tray.
US11938902B2
A sliding vehicle center console is provided. The center console may include an elongated rack, including an elongated rack, defining a plurality of teeth, a carrier member coupled to the rack, and a gearbox assembly including a pinion configured to rotate in a first or a second direction to translate the carrier member and the elongated rack from a first position to a second position. The sliding vehicle center console may also include a controller configured to change the rotation of the pinion from one of the first or second directions to the other directions, responsive to a comparison of a sensor value to a threshold condition.
US11938900B2
In one example embodiment, a computer-implemented method and system for immobilization of machines capable of moving are disclosed. The method for immobilization of machines capable of moving includes detecting an event by a tracking device; providing one or more rules to evaluate the detected event; evaluating the detected event using the one or more rules; and triggering an action type based on the outcome of the evaluation. The system for immobilization of machines capable of moving includes a machine capable of moving, a tracking device including at least one processor and logic, a starter relay and a fuel pump relay, wherein the tracking device detects an event; evaluates the detected event using one or more rules provided to evaluate the detected event; and triggers an action type based on the outcome of the evaluation.
US11938895B2
A sensor integration module for detecting vehicle interior information and an operation method thereof are provided. The sensor integration module includes: a first sensor enabled based on first operation information and providing a sensing result as first sensing information; a second sensor enabled based on second operation information and providing a sensing result as second sensing information; a first communication device that transmits and receives information with electronic devices in a vehicle; and a controller that generates the first and second operation information for selectively enabling the first and second sensors based on information provided from the first communication device and provides the first communication device with the result determined based on the first and second sensing information.
US11938893B2
An embodiment seat belt mounting structure includes a front seat disposed towards a front of a vehicle body, a rear seat disposed towards a rear of the vehicle body, a center pillar part, a rear pillar part disposed behind the center pillar part, a side reinforcement connecting the center pillar part and the rear pillar part, and a rear seat retractor coupled to the side reinforcement.
US11938889B2
An air bag is configured to be miniaturized by a foldable structure of an air bag cushion in a driver seat and to safely protect a driver by enlarging a protection area thereof, and the air bag includes a first folded part configured to be folded in a vertical direction of an air bag cushion, and wherein the first folded part is unfolded in deployment to increase a vertical length of the air bag cushion, and a second folded part configured to be folded in leftward and rightward directions of the air bag cushion, and wherein the second folded part is unfolded in deployment to increase a transverse length of the air bag cushion.
US11938883B2
A deployment ramp helps to direct a side airbag to deploy along a desired deployment trajectory from a vehicle seatback to a deployed position adjacent a side structure of the vehicle. The deployment ramp includes a mounting wall configured to be connected to a seat frame of the seatback. The deployment ramp also includes a deployment wall configured to deflect outboard of the vehicle seatback in response to airbag deployment and at least partially cover padding and/or a cover of the seatback. The deployment ramp further includes a bottom wall that extends between the mounting wall and the deployment wall, the bottom wall forming a reaction surface for side airbag deployment in the deployment trajectory.
US11938880B2
Systems and methods for detecting low impact collisions for a vehicle (100). The system includes at least one sensor (99, 110, 111, 115, 120-123, 125-136, 140, 141) and an electronic controller (150). The electronic controller (150) is configured to receive sensor data from the sensor (99, 110, 111, 115, 120-123, 125-136, 140, 141) and determine one or more features of the sensor data received from the at least one sensor. The electronic controller (150) is further configured to determine if a collision has occurred based upon the one or more features of the sensor data, and take at least one action in response to determining that the collision has occurred.
US11938877B2
A method includes detecting a determined operating condition of a first power converter that is one of a plurality of first power converters in a power generating unit, and the power generating unit is one of a plurality of power generating units. The method further includes responding to detection of the determined operating condition by: controlling, via at least one remaining first power converter of the plurality of first power converters, a load current flowing through a power bus coupled to the plurality of power generating units, and altering one or more droop characteristics corresponding to one or more second power converters disposed in other power generating units based at least in part on the controlled load current flowing through the power bus, wherein the one or more second power converters disposed in other power generating units are coupled to the power bus.
US11938876B2
An electrical unit and method of assembly that includes a base housing having a plurality of sides and an opening in one of the sides configured to receive a wire therethrough, and a cover configured to mate with the base housing, defining an internal chamber therebetween. A power distribution box is disposed within the internal chamber, at least one electrical connector is disposed at least partially within the internal chamber, operatively engaging the power distribution box, and extending through the opening, and a universal sealing plate that is selectively mountable on each side of the power distribution box and mounted to align with and seal against sides of the opening and at least a portion of the electric connector extending through the opening.
US11938873B2
A repositionable toilet system for a bathroom or water closet of an RV, camper, boat, or other portable living quarter, allows for a dry bath (including a shower stall that can be somewhat isolated from the toilet) without permanently sacrificing otherwise useful floor space within the living quarter. The toilet is supported on a moveable platform that is repositionable between a stowed position in which the toilet is inside of the shower stall and a deployed/extended position in which the toilet is outside the shower stall. The moveable platform may be locked at the stowed or deployed position during travel or during use of the living quarter. The toilet may be fully self-contained, refillable, and emptyable, or the toilet may be plumbed into the water supply and waste collection system of the RV or camper, such as with flexible supply and drain lines.
US11938862B2
A hazard beacon has an interface to a vehicle wiring harness configured to detect that vehicle emergency indicators have been deployed, a plurality of separately strobe capable light segments forming a hazard symbol, and a microcontroller controlling operation of the plurality of separately strobe capable light segments.
US11938861B2
An auxiliary lighting system for a helmet operable with a lighting system of a vehicle comprising a vehicle brake light, comprised of a helmet portion and a vehicle portion. The helmet portion is comprised of a helmet lighting unit, a microcontroller in communication with the helmet brake light, and a helmet transceiver in communication with the microcontroller. The vehicle portion is comprised of a supporting body, a vehicle transceiver, and an accelerometer joined to the supporting body and in communication with the microcontroller. The microcontroller is programmed with an algorithm such that the microcontroller receives a signal indicative of the relative position of the accelerometer, determines the performance capability of the accelerometer in detecting acceleration of the vehicle with respect to the Earth based upon the signal indicative of the position of the accelerometer, and presents an indication of accelerometer performance capability.
US11938859B2
A searchlight system for mounting to a vehicle, for example on the A-pillar, without requiring modification to structural frame components. The system comprises a mounting assembly which is installed on the vehicle and a searchlight assembly which is mounted to the mounting assembly. Searchlight assemblies with different optical devices can be modularly exchanged with respect to the same mounting assembly installed on the vehicle. Also disclosed is a method for installing such systems. Other aspects are directed to heat dissipation and ingress protection for the searchlight assembly.
US11938857B2
A Reusable Stretching Tie-Down With Locking Links that is made up of two ends (tabs) and a plurality of links and joints between the ends. The two ends are composed of a beveled, wedged tip connected to a flat plane. The two ends are joined together by an alternating chain of links and joints. The Tie-Down can be used to secure objects in many applications, such as cargo in transportation systems, farming/gardening equipment, camping equipment, etc.
US11938855B1
A seat for a vehicle may include a seatback including a variable resistance support disposed within a volume of the seatback. The variable resistance support may further include one or more configurable arrays of resistive elements including collapsible structures and/or inflatable bladders that may be configured to provide energy dissipation and/or absorption during a collision event. One or more array subsets may be configured to be independently controllable and configured to provide adjustable support at a region of the seatback, the adjustable support corresponding to a mass of the occupant. Moreover, when at least a portion of the back of an occupant pushes against a front surface of the seatback due to the collision event, the arrays of resistive elements may be configured to compress and/or collapse, at least partially, to absorb an energy applied from an occupant's back associated with the collision event.
US11938850B2
A vehicle seat includes a seat bottom and a seat back extending upwardly from the seat bottom. A cushion is included in each of the seat bottom and seat back. A stream of air is provided to at least one of the seat bottom and the seat back to provide a ventilated vehicle seat for a passenger seated on the vehicle seat.
US11938849B2
A seat for a vehicle having a fold-and-dive function is proposed. When a seatback is rotated forwards and folded, a seat cushion is moved down, so the fold-and-dive function of the seat is realized. When a full-flat mode is realized by the reclining operation of the seatback, a rear end of the seat cushion is moved up, so a step between the seat cushion and the seatback can be significantly reduced or eliminated. Furthermore, a front link connecting a back cushion interlocking frame and a cushion fixing bracket to perform the fold-and-dive function is installed to have directivity where it is inclined rearwards, thus preventing a submarine phenomenon of the seat in the event of a forward collision.
US11938848B2
A child restraint system is provided and configured to be installed on a vehicle seat to support a child. The child restraint system includes a main body, a reclining foot and an adjusting foot. The main body includes a seat portion and a backrest portion. The reclining foot is pivotably coupled to the main body. The adjusting foot is pivotably coupled to the main body or the reclining foot. The adjusting foot is pivotable between a forward position and a rearward position. No matter when the child restraint system is in a rearward-facing direction or a forward-facing direction, the child restraint system can be supported stably on the vehicle seat, and a recline position of the child restraint system can be adjusted in a wide adjustment range by pivoting of the reclining foot. Therefore, the child restraint system is convenient to use.
US11938839B2
A system in a vehicle includes two or more smart battery packs to power drive units of the vehicle to move the vehicle. Each of the two or more smart battery packs includes a battery pack, and a battery management system (BMS) to monitor a state of charge of the battery pack. An energy distribution unit facilitates charge transfer among the two or more smart battery packs.
US11938835B2
A fuel cell system includes a fuel cell generator, a rechargeable energy storage circuit, an auxiliary load, a converter circuit, and a switch circuit. The fuel cell generator is operable to generate electrical power in a stack output signal. The auxiliary load is powered by the rechargeable energy storage circuit while in a first mode, and powered by a local signal while in a second mode. The converter circuit is operable to convert the stack output signal into a plurality of recharge signals while in the first mode and in the second mode, and convert the stack output signal into the local signal while in the second mode. The switch circuit is operable switch the plurality of recharge signals to one or more electric vehicles, and switch the local signal to the auxiliary load while in the second mode.
US11938831B2
An integrated fuel management system can include a switching unit coupled to an electric vehicle (EV) charging station, a computer system, a first electronic unit, and a second electronic unit. The first electronic unit can be coupled to the switching unit and operable for providing state information for the EV charging station to the computer system. The second electronic unit can be coupled to a fueling station for types of vehicles that use fuel and operable for providing state information for the fueling station to the computer system. Further, the computer system can be operable for displaying the state information for the EV charging station and for displaying the state information for the fueling station.
US11938830B2
Exemplary embodiments are directed to wireless charging and wireless power alignment of wireless power antennas associated with a vehicle. A wireless power charging apparatus includes an antenna including first and second orthogonal magnetic elements for detecting a horizontal component of a magnetic field generated from a second charging base antenna. A processor determines a directional vector between the antennas.
US11938823B2
An operating unit includes a touch-sensitive operating area and control unit. The control unit determines an activation location on the operating area from the information relating to the touched regions. If the activation location is in a predefined field, the control unit performs a function assigned to the field. The control unit determines the activation location from a position on or in the region of a boundary line bounding a fingertip and that is at the front in the direction of movement of the finger on the surface of the operating area, only when a determined speed of movement of a course of the regions of the touched operating exceeds a predefined limit value. Otherwise, the activation location is determined from an area centroid of all regions of the operating area which have been touched by the finger at a point in time.
US11938819B2
A method performed by a vehicle feature evaluation system for enabling evaluation of a simulated vehicle-related feature. The vehicle feature evaluation system determines in relation to a road-driven vehicle, with support from a tracking system, an orientation of a head-mounted display, HMD, adapted to be worn by an occupant on-board the road-driven vehicle or position and gaze direction of the occupant. The vehicle feature evaluation system further determines a simulated vehicle design feature to be evaluated in the road-driven vehicle. Moreover, the vehicle feature evaluation system provides in real-time to a HMD display of the HMD or another display, taking into consideration the HMD orientation or position and gaze direction, a virtual representation of the simulated vehicle design feature superimposed on a real-time surrounding-showing image derived from real-world perception sensor data captured with support from one or more vehicle-attached perception sensors adapted to capture surroundings internal or external to the road-driven vehicle.
US11938808B2
There is provided an anti-siphon device for securing in a fluid tank inlet. The anti-siphon device comprises a housing, an inlet to the housing adapted to receive a fluid dispensing nozzle, the inlet at a proximal end of the hosing, and an outlet at a distal end of the housing. The anti-siphon device further comprises an obstruction disposed within the housing, where an outer surface of the obstruction and an inner wall of the housing define a first flow passageway. The obstruction comprises, a chamber disposed within the obstruction and configured to receive fluid, an inlet aperture in a first portion of the obstruction, and an outlet aperture in a second portion of the obstruction, where the inlet aperture, chamber, and outlet aperture define a second flow passageway, the second flow passageway being configured such that, in use, fluid can flow from the inlet aperture to the outlet aperture via the second flow passageway, whilst flows from the inlet to the outlet via the first flow passageway.
US11938805B2
Reconfiguration of diesel-powered haul truck with hybrid hydrogen fuel cell and battery power supply
The present disclosure provides a mining haul truck with the diesel-powered components removed, the resulting available volumes retrofitted with components of a hybrid hydrogen fuel cell/battery-based powerplant. In some embodiments, the tray and/or the canopy of the haul truck can be replaced or reconfigured to create an additional volume for receiving components of the hybrid hydrogen fuel cell/battery-based powerplant.
US11938801B2
To provide a vehicle drive device capable of effectively driving a vehicle by using in-wheel motors without falling into the vicious cycle between enhancement of driving via the motors and an increase in vehicle weight. The present invention is a vehicle drive device that uses in-wheel motors to drive a vehicle and includes in-wheel motors (20) that are provided in wheels (2b) of a vehicle (1) and drive the wheels, a body side motor (16) that is provided in a body of the vehicle and drives the wheels of the vehicle, and a battery (18) and a capacitor (22) that supply electric power for driving the in-wheel motors and/or the body side motor, in which a voltage of the battery is applied to the body side motor and a voltage of the battery and the capacitor connected in series is applied to the in-wheel motors.
US11938796B2
A vehicle having an exoskeleton exterior panel that provides crash resistance is described. The exterior panel may be formed from a monolithic metal sheet and attached to an exterior portion of the vehicle frame, and the exterior panel does not comprise an additional support structure. At least one component may be directly attached to the exterior panel, and the exterior panel may bear the load of the at least one component. Methods of manufacturing the vehicle are also described.
US11938791B1
A vehicle window opacity system that includes a vehicle window system comprising a front windshield, side windows, and a rear window, a liquid crystal display system coupled to the vehicle window system, and a controller coupled to the liquid crystal display system. The controller is operable to control an opacity of a portion of the liquid crystal display system coupled to at least one side window relative to the front windshield to reduce and/or block light from passing through the at least one side window based on information regarding a light source.
US11938788B2
A fluid heating system intended for use in recreational vehicles that circulates glycol in a system loop with various heat sources and other devices that distribute this heat to an enclosure or a domestic water system. It has a system controller operationally connected to a remove tactile display unit that allows for the input of the operation parameters to the system controller. The control unit is operatively connected for data and signal transfer to the user's cell phone via a non-internet connected localized wi-fi network. This provides the user with system status information, fault codes and allows selected operational functions and resets to be remotely initiated that heretofore required local manipulation. It also incorporates altimeter to allow the furnace controller to maximize its burn efficiency.
US11938781B2
A vehicular heat management system includes a refrigerant circulation line configured to generate hot energy or cold energy depending on a flow direction of a refrigerant, a heater core side coolant circulation line configured to transfer refrigerant heat generated in the refrigerant circulation line to a heater core to heat a passenger compartment, and a battery side coolant circulation line configured to receive coolant heat of the heater core side coolant circulation line via a coolant and then circulate the coolant through a battery to preheat the battery.
US11938780B2
A wheel suspension and transmission gear assembly may include: a main arm pivotally connectable at a connection point of the main arm to a shaft point of a wheel; a first linkage unit pivotally connected at its first end to the main arm; and a second linkage unit pivotally connected at its first end to the main arm such that at least a portion of the main arm is between the first linkage unit and the second linkage unit and such that a second end of the first linkage unit and a second end of the second linkage unit are at opposing sides of the main arm with respect to each other; wherein (i) the main arm and (ii) the first linkage unit or the second linkage unit each may include: a first gear and a second gear pivotally connected thereto and interconnected to transmit rotational motion between each other.
US11938778B2
A clamp for securing a link to a bar or a rod in order to accommodate multiple connection points. The clamp or sway bar clamp includes multiple connection points for securing a link to a sway bar. The sway bar clamp goes over the end of the sway bar. It converts a sway bar with one connection point to a sway bar with multiple connection points to adjust flex of the sway bar.
US11938776B1
An active suspension control system for a vehicle includes a mathematical model based on a modal expansion of the vehicle. Model parameters of the vehicle can be extracted from the modal expansion using sensor data generated on the vehicle, e.g., on demand and/or in real time. The model parameters and the modal expansion can be used to determine a vehicle state, predict future vehicle states, and control aspects of an active suspension system based on the predicted future vehicle states. The model parameters may also be used to update the mathematical model, e.g., to account for component wear over time, and/or to detect anomalies or defects in the active suspension system.
US11938775B2
A damping control system comprises a first vehicle, a second vehicle, and a storage device. The first vehicle provides, to the storage device, travel information including a change value of a road surface, position information, and position reliability of the position information. The storage device executes first update processing of updating related value information based on a road surface displacement-related value identified based on the change value, when the position reliability is equal to or higher than a threshold reliability, and executes second update processing of updating the related value information, when the position reliability is lower than the threshold reliability. The second vehicle executes preview damping control using a target control force calculated based on a control related value being a road surface displacement-related value at a predicted passing position.
US11938769B2
A leaf spring apparatus for a vehicle suspension includes a leaf spring, a carrier disposed on an end portion of the leaf spring and mounted on a wheel of a vehicle, a first connection unit connecting the end portion of the leaf spring and the carrier to each other, a cross member disposed on top of the leaf spring and supporting a body of the vehicle, and a second connection unit connecting the leaf spring and the cross member to each other.
US11938766B2
The present disclosure includes a system, method, and device related to data collection and communication related to after-market and external vehicle systems, such as towing systems, cargo carrying systems, trailer breakaway systems, brake systems, braking control systems, and the like. Data is sensed, processed, shared, and further leveraged throughout the discrete components of the system, and possibly via internet and other communications' links, to effect various beneficial actions with minimal driver/user interaction or intervention. In the same manner, data from the system may be used for diagnostic reasons, safety controls, and other purposes.
US11938764B2
An air deflector that is at least partially disposable within a tubeless tire of a bicycle wheel includes a body. The body includes at least one wall defining an air input end and an air output end of the body. The body is attachable to a valve of the tubeless tire at the air input end, such that when air is introduced into the body via the valve, at least some of the air is deflectable by one or more walls of the at least one wall out of the body at the air output end.
US11938763B2
This present invention relates to an anti-skid device adapted to being mounted on tyres of the vehicle wheels to provide traction and wheel to ground contact enhancement in snowy and icy conditions. The device includes a central housing 2 from which protrudes radially three arms 3 which are extended at the outer end by anti-slip components 10 transversally embracing the tread of the tyre. The anti-skid device have a locking mechanism that consists of a locking element 24 with teeth engaging with teeth on the inner circumference of the housing 2. A handle 16 integrated into the hub 4 interfaces with the locking element 24 to securely maintain the locked status when the device is mounted onto the wheel.
US11938757B2
A wheel suspension system, comprising, a wheel rim, a plurality of adaptors equidistantly mounted on inner periphery of the wheel rim, a plurality of suspension curved elastic members having drafted ends configured to be circumferentially and linearly disposed into the adaptor along the wheel rim, and a multi-layered hub having a plurality of interlocked holders away from its centre towards the wheel rim for interlocking the elastic members at the centre. The wheel suspension system is cost effective for both users and manufacturers, user friendly, comfortable, easy to assemble or disassemble, comfortable and provides safety in cases of accidents.
US11938756B2
A method for controlling a device for metering granular material and a metering device for metering granular material comprises a feed for the granular material from a container into a metering chamber. A metering piston can be actuated by a control device such that a gap between the feed and the metering chamber is opened by a predefined first distance and a second distance which is greater than the first distance. At least one sensor is arranged in a delivery line leading away from the metering chamber and is connected to the control device so that the metering piston can be actuated for a predefined duration such that the gap between the feed for the granular material and the metering chamber can be opened by the second distance if a blockage of the granular material is detected by the at least one sensor, so that the blockage is dispersed.
US11938755B2
A split-type hard front axle includes an axle housing; an axle tube connected to the axle housing; an inner-C-forging located at an end of the axle tube for connecting with a kingpin knuckle; and a connection structure cooperated with the inner-C-forgoing, for detachably fixing the inner-C-forging on the axle tube. The axle tube is provided with a first angle adjustment structure. The inner-C-forging is provided with a second angle adjustment structure. The inner-C-forging is sleeved on the axle tube, and the connection structure is inserted into the axle tube, to fix the inner-C-forging on the axle tube. The first angle adjustment structure is capable of cooperating with different portions of the second angle adjustment structure to make the inner-C-forging have different installation angles on the axle tube, and a caster to pinion angle is different at inner-C-forging's different installation angles. A vehicle is also provided.
US11938747B2
A datapage of a security document includes a non-planar end face that is to be connected to a hinge material, thereby providing for increased overall contact surface area between hinge material and the datapage. Consequently, a respective connecting portion including such an interdigitated structure may provide for superior robustness while still ensuring a high degree of integrity of the datapage and a robust mechanical connection to the remainder of the security document.
US11938744B2
A device for providing a marking arranged or arrangeable around an object includes: a mechanical interface for releasably or irreversibly mounting the device to a printer; a material interface for receiving a print medium, which is printed by the printer using a print head, as a printed product in a longitudinal direction; at least one eccentric supported at the material interface to be pivotable about a pivot axis; and at least one print head actuator for moving the at least one eccentric to a first pivot position and to a second pivot position different from the first pivot position to provide the marking originating from the printed product. The eccentric, in a state of the device mounted to the printer using the mechanical interface, moves the print head and the print medium towards each other into a printing position for printing the print medium when the eccentric moves.
US11938743B2
An example printing apparatus is illustrated. The printing apparatus includes a print engine assembly. The print engine assembly further includes a bottom chassis portion. The print engine assembly also includes a top chassis portion. The print engine assembly also includes a print head positioned within the top chassis portion. The print engine assembly also includes a plurality of offset pins coupled to the print head, where the plurality of offset pins abuts the bottom chassis portion, and where the plurality of offset pins enables the print head to be positioned at a predetermined distance from the bottom chassis portion.
US11938742B2
A printing apparatus includes: a conveying roller which conveys a print medium in a conveying direction; a line head having first and second nozzle rows arranged in the conveying direction; and a controller. Each of the first and second nozzle rows includes nozzles aligned along a width direction orthogonal to the conveying direction. The nozzles are configured to discharge liquid, and the nozzles in the first nozzle row and the nozzles in the second nozzle row are shifted in the width direction. The first nozzle row has: first nozzles forming a group; and second nozzles forming a group adjacently in the width direction to the group of first nozzles in the first nozzle row. The second nozzle row has: first nozzles forming a group; and second nozzles forming a group adjacently in the width direction to the group of first nozzles in the second nozzle row.
US11938736B2
A printing liquid container includes first and second members having a supply port and a valve, respectively. The members rotate with respect to each other between first and second states. The valve closes and opens the supply port in the first and second states, respectively. The first and second members have first and second fitting portions, respectively. The fitting portions fit to a fitted portion of a tank in the first state. The second fitting portion allows rotation of the second member with respect to the fitted portion when the first fitting portion are fitted to the fitting portion. The first member does not rotate together with the second member due to fitting between the fitted portion and the first fitting portion. The second member cannot be removed from the fitted portion due to fitting of the second fitting portion to the fitted portion in the second state.
US11938724B2
A post-processing device includes a first discharge unit, a processing tray, an end alignment portion, a transport unit that comes into contact with an upperface of a medium placed on the processing tray and transports the medium to the end alignment portion, a position changing unit that changes the relative position of the transport unit with respect to the processing tray, a controller, and a post-processing unit that performs a post-process on the medium on the processing tray, wherein the position changing unit is configured to move the transport unit to a transport position to which the medium is transported and a standby position farther away from the processing tray than the transport position, wherein the controller changes the standby position based on the processing information related to the process performed on the medium, and wherein the processing information includes information about a process performed on the first medium.
US11938723B2
A print element substrate, comprising a plurality of functional elements, a plurality of driving elements configured to drive the plurality of functional elements based upon one of a plurality of drive signals, a shift register configured to store functional data indicating whether or not to drive the functional element, a data analyzing unit configured to analyze the functional data input into the shift register, and a drive signal selection unit configured to select one of the plurality of drive signals in response to an analysis result from the data analyzing unit.
US11938722B2
A fluid ejection device includes a plurality of fluid actuation devices, a plurality of memory cells, and a configuration register. Each memory cell of the plurality of memory cells corresponds to a fluid actuation device of the plurality of fluid actuation devices. The configuration register stores data to enable or disable access to the plurality of memory cells.
US11938718B2
In an example of the disclosure, power of a first light beam emitted across a web media along a length of the roller is measured utilizing a first optical transmitter and first optical receiver pair situated adjacent to a roller. Power of a second light beam emitted across a length of the roller is measured utilizing a second optical transmitter and second optical receiver pair situated adjacent to the roller. A media height non-uniformity is identified based upon of the measurement of the power of the first light beam and the measurement of the power of the second light beam.
US11938702B2
A method for laminating glass sheets is disclosed. A sandwich structure sheet moving in a heating furnace on rollers is heated by two-sided hot air blasting which is carried out by several successive blowing aperture sections, and, to reduce or prevent the formation of air bubbles in finished laminated glass, the heating of the rear end of the sandwich structure sheet is prevented by cutting off the hot air blasting of at least one blowing aperture section when the rear edge of the sandwich structure sheet approaches the blowing aperture section. An apparatus for laminating glass sheets is also disclosed, comprising a heating furnace, a pair of press rolls and means for establishing location data on the sandwich structure sheet. The heating furnace is provided with a roller track, a blower, a heating resistor, an air distribution conduit, and several successive blowing boxes with closing means.
US11938701B2
A glazing includes at least one transparent substrate comprising a first major surface and an opposing second major surface, wherein said first major surface is coated with an electrically conductive layer and the electrically conductive layer is absent in one or more regions of the first major surface. At least a portion of the one or more regions of the first major surface, and/or corresponding regions of the opposing second major surface, bears a low-emissivity material, and the one or more regions permit the passage of electromagnetic radiation through the glazing.
US11938700B2
A system and method are provided for forming one-way light transmissive layers implementing optical light scattering techniques in those layers, and to objects, object portions, lenses, filters, screens and the like that are formed of, or that otherwise incorporate, such one-way light transmissive layers. Processes are provided by which to form, or otherwise incorporate, one or more one-way light transmissive, or substantially transparent, object portions or layers in solid or hollow objects Individual one-way light transmissive layers are formed of substantially-transparent sub-micrometer spheres, including micro-particles and/or nano-particles, with nano-voids incorporated between them. Refractive indices of the sub-micrometer particles are tunable in order that the finished layers provide an opaque appearance when viewed from a light incident side that is rendered according to an individual user's desires, but that are substantially-transparent to light passing through the finished layers to areas or sensors behind those finished layers.
US11938689B2
An apparatus for processing a composite structure includes a first processing-tool and a second processing-tool that are movable between an open position, in which the first processing-tool and the second processing-tool are separated from each other, and a closed position, in which the first processing-tool and the second processing-tool are configured to be sealed to each other. In the closed position, the first processing-tool and the second processing-tool are configured to be sealed to a mandrel-tool, located between the first processing-tool and the second processing-tool and supporting the composite structure. In the closed position, the first processing-tool, the second processing-tool, and the mandrel-tool form a vessel, configured to apply at least one of pressure and heat to the composite structure.
US11938687B2
A plant fiber-containing composite resin molded article contains a base resin, plant fibers, and, a dispersant, in which each of the plant fibers contains an aroma component, the base resin is a crystalline resin, and in a case where a total content of the base resin, the plant fibers, and the dispersant is 100% by mass, a content of the plant fibers is more than or equal to 50% by mass and less than or equal to 90% by mass.
US11938679B2
A three-dimensional (3D) printing system includes a resin vessel, a fabrication subsystem, a waste collection subsystem, and a controller. The resin vessel is configured to contain photocurable resin. The fabrication subsystem is configured to form the 3D article with layer-by-layer selective curing of the photocurable resin. The fabrication subsystem includes a build plate, a build plate support structure, and a vertical movement mechanism. The waste collection subsystem is attached to the build plate support structure and configured to capture partially polymerized resin as the build plate support structure moves in an upward direction. The controller is configured to (a) operate the vertical movement mechanism to translate the build plate support structure to a lower position and (b) operate the vertical movement mechanism to raise the waste collection subsystem up through the resin and to a position at which partially polymerized resin can be unloaded from the waste collection subsystem.
US11938678B2
Disclosed herein are an adhesion blocking element, a three-dimensional printing device and a three-dimensional printing method. The adhesion blocking element comprises: one light-transmittable main body comprising a first surface and a second surface which are disposed opposite to each other, and side faces connecting the first surface and the second surface; and a plurality of microstructures arranged on the main body, wherein each microstructure has one cavity formed in the main body and one first open face which is arranged on the first surface of the main body and communicated to the cavity. The present invention decreases the adhesion between the adhesion blocking element and the cured layer by improving the structure of the adhesion blocking element itself, and eliminates the negative pressure adsorption between the cured layer and the adhesion blocking element, so that it is easier to peel the adhesion blocking element off from the cured layer. Meanwhile, the service life of the adhesion blocking element is prolonged by enhancing the local elastic deformability of the adhesion blocking element. In addition, the release layer adopted in the present invention is liquid, and the formed three-dimensional construct is solid, which makes the three-dimensional construct and the release layer more easily separated, thereby improving the speed of three-dimensional manufacturing.
US11938676B2
Provided is a molding technique with which a molding operation is performed smoothly, preventing the production of defective products. Also provided is a molding apparatus including a nozzle, a guide member guiding a molding material to the nozzle, and a heating device, the molding apparatus being further provided with a prevention structure configured to prevent the molding material from melting during transportation through the guide member.
US11938675B2
The present invention discloses a three-dimensional printing device, comprising: a chassis, a light source and a controller, wherein a liquid storage tank is arranged in the middle of the chassis, an anti-sticking element is arranged on the inner wall of the liquid storage tank, and the liquid storage tank is used for holding polymerizable liquid; and further comprising: a base which is adapted to the liquid storage tank in a para-position way, wherein the base is connected with a driving device, and the light source is matched with the bottom of the base. By using the anti-sticking element as a covering part for the liquid storage tank, the forming part formed by curing the polymerizable liquid can lose contact with the anti-sticking element quickly and efficiently, so as to carry out further formation and processing operations. In this way, the whole three-dimensional printing process is more rapid and efficient. Meanwhile, the damage to the structure of the product or component caused by excessive adhesion during the separation of the formed product from the device component is effectively avoided, and therefore the processing effect of the product and the stable operation of the device component are ensured. The present invention further discloses a three-dimensional printing method using the above three-dimensional printing device.
US11938673B2
The invention relates to the use of a compatible thermoplastic material (film, sheet, or raft) as the base sheet or layer for 3-D printing an article. The use of the base film provides a means of printing a large article, and of reducing warpage by printing directly on the film. The printed article adheres to the film better than to traditional printer surfaces (glass, metal, glue, or reusable films), because the printed article and film weld together by forming chain entanglements, due to being compatible, miscible, or semi-miscible in the melt.
US11938669B2
A blow molded container is provided. The container includes a neck having a neck finish and a transverse rim that defines an opening. A closure is provided that is engageable with the neck such that the rim is movable relative to the neck to define one or more vents configured for passage of a gas. In some embodiments, methods of use and manufacturing containers are disclosed.
US11938666B2
A storage container manufactured from an injection molding process which includes a mold and at least one injector. The mold has a top surface, a bottom wall, a plurality of side surfaces, and at least two separable sections. Where the at least two separable sections are in a closed position, a cavity is formed in the mold. The at least one injector is disposed through at least one of the plurality of sidewalls and further disposed into the cavity. The storage container has a plurality of sidewalls, an upper edge, and a bottom surface. At least one of the plurality of sidewalls of the resulting storage container contains at least one sprue mark.
US11938665B2
A process for molding one or more bottle preforms, wherein molten plastic is injected into at least one molding cavity; and wherein air is drawn from the at least one molding cavity, through at least one channel for the air to pass from the at least one molding cavity towards the outside of the molding device, by means of suction means; and apparatus and device for performing such a process.
US11938664B2
A method and apparatus for producing hollow articles made of injection moulded plastic material by a mould having a die within which there is inserted a core, and at least one injector including a pin valve displaceable between a closing position and an opening position for injecting the pressurized plastic material into a space comprised between the die and the core. During the injection, any flexural deflection of the core is detected and the pin valve of the or of each injector is displaced in a controlled fashion to adjust a pressure and a flow rate of the injected plastic material, so as to reduce or eliminate such deflection of the core.
US11938661B2
A device for injection molding a molded part having an insert includes a mold having a mold cavity, an insert loading device having an insert push rod for positioning an insert in the mold cavity, a magazine having inserts arranged side by side and aligned with the insert push rod, and an insert feed channel ending in the mold cavity and into which the insert aligned with the one insert push rod can be pushed out of the one magazine by means of the insert push rod. The magazine has a horizontally aligned insert receiving surface having adjacent placement positions for the inserts, the placement positions being adapted to the contour of the inserts. The magazine has a loading region having at least one freely accessible placement position for mechanically loading the same with an insert.
US11938660B2
A mold die includes: a mold die body that is configured to hold an object to be molded, the object including a substrate and a chip mounted in a central area of the substrate, and that has a cavity which is rectangular in a plan view and which is configured to receive a resin material, the mold die body including: a pot for containing the resin material; a gate disposed at one side of the cavity and configured to allow the resin material to flow into the cavity; and a flow-path restricting mechanism that is disposed on both lateral sides of the cavity that are perpendicular to the one side and that is configured to narrow lateral flow paths, the lateral flow paths being flow paths for the resin material flowing through the cavity in which the chip is not disposed.
US11938656B2
A method of manufacturing an impregnated fibrous material including a fibrous material made of continuous fibers and at least one thermoplastic polymer matrix, the method including pre-impregnating the fibrous material while it is in the form of a roving or several parallel rovings with the thermoplastic material and heating the thermoplastic matrix for melting, or maintaining in the molten state, the thermoplastic polymer after pre-impregnation, the at least one heating step being carried out by means of at least one heat-conducting spreading part (E) and at least one heating system, with the exception of a heated calendar, the roving or the rovings being in contact with part or all of the surface of the at least one spreading part (E) and partially or wholly passing over the surface of the at least one spreading part (E) at the level of the heating system.
US11938652B2
Plant (2) for the production of slabs made of composite stone material from a mix (M) containing granules of stone or ceramic or glass material and a binder, comprising at least one temporary support or mould (S), a distributor for the mix (M) designed to distribute a layer of mix (M) on the temporary support or mould (S), a station (4) for performing compaction by means of vacuum vibro-compression of the mix (M) arranged on the temporary support or mould (S) and a station for hardening the mix (M) so as to form the finished slabs. The plant (2) comprises a device (1) positioned downstream of the distributor and upstream of the compaction station (4) and comprising means (16) which act on the top surface of the mix (M) for pre-compaction and levelling of the mix (M) arranged on the temporary support or mould (S). The invention also relates to a method for the production of slabs of composite stone material from a mix (M).
US11938651B2
A method for producing a concrete tube for a hyperloop passenger transport system. The concrete tube is concreted in situ by means of a formwork device. The formwork device has a formwork carriage which moves forwards during concreting. The formwork carriage has an inner form and an outer form for shuttering the concrete tube. An interspace between the inner form and outer form is filled, in particular continuously, with concrete. The solidified concrete tube can be supported on pillars via bearings. The freshly solidified portion of the concrete tube is preferably supported on the inside by inner rollers and on the outside by outer rollers. In order to support the formwork carriage on the pillars, the formwork device can have supporting rollers. The formwork device for implementing the method and to the concrete tube produced by the method for the hyperloop passenger transport system.
US11938645B2
Provided is a cutting implement which is easily ground or which needs no grinding and is safe. The cutting implement is a cutting implement including an acting portion 3 that cuts an object to be cut, the cutting implement configured such that the acting portion 3 includes a main body portion 4 and a small thickness portion 5 whose thickness is smaller than the thickness of the main body portion 4 and the small thickness portion 5 has a width of 2.5 to 20 mm and a thickness of 0.1 to 0.5 mm.
US11938636B2
A feature-guided scanning trajectory optimization method for a 3D measurement robot, including: building a 3D digital model of an aircraft surface; obtaining a size of the 3D digital model; extracting features to be measured; classifying the features to be measured; calculating a geometric parameter of each type of features to be measured; generating an initial scanning trajectory of each type of features to be measured; building a constraint model of the 3D measurement robot; optimizing the initial scanning trajectory into a local optimal scanning trajectory; and planning a global optimal scanning trajectory of each type of features to be measured on the aircraft surface by using a modified ant colony optimization algorithm.
US11938622B2
A housing includes: a housing body that contains at least one electromechanical or mechanical component, the housing body including a front plate and a pair of side plates, the plates being connected to a bottom plate in such a manner that the housing body includes an opening; a cover for closing the opening; and a gasket interposed between an edge portion of the housing body and an edge portion of the cover to tightly close an inside of the housing body. An edge portion of each of the side plates has a curved shape.
US11938621B2
The present application relates to the technical field of robot joints, and discloses a robot dual-joint unit, and a legged robot and a cooperative manipulator using the same. The robot dual-joint unit includes a first joint consisting of a first motor and reducer assembly, a second joint consisting of a second motor assembly and a second reducer; a first output connecting rod is fixedly provided on an output shaft of the first motor and reducer assembly, the second reducer is provided in the first output connecting rod, and the second motor assembly drives the second reducer through a transmission rod. In the present application, a fixed end of the second motor assembly is fixed with a fixed end of the first motor and reducer assembly, rather than a fixed end of a second motor of a conventional robot joint series structure is fixed on an output end of a first motor and reducer assembly, such that the output inertia of two output shafts of the robot dual-joint is smaller, and a power cable leading to the second motor assembly of the second joint is omitted.
US11938616B2
A lockbolt swage end effector incorporates a swage tool releasably engaged by a connector assembly to hydraulic operator carried in a frame. A two piece core-bolt operably connects the swage tool and the hydraulic operator through the connector assembly. A connection flange attaches the frame to a mating flange on a robotic manipulator.
US11938611B2
A portable power tool includes an electromotive drive with an output shaft defining a first axis and having a first end portion and a second opposite end portion. The first end portion is between a mounted machining tool and the second end portion. The electromotive drive is received in a first power tool housing portion and includes a stator having a first stator end defining a first plane and a second stator end defining a second plane, the first plane is located between the first end portion and the second plane. A second power tool housing portion defines a handle gripping portion with a first surface defining a third plane which intersects the output shaft at a location whereat the first plane is between the third plane and the second plane. A second surface portion opposite the first surface portion defines a fourth plane parallel to the third plane.
US11938608B2
A working machine includes a housing, a motor, an operating part, and an on-locking unit. The motor is accommodated in the housing. The operating part is a part of the housing. The operating part is movable between an on position and an off position. The motor is driven when the operating part is in the on position, and is stopped when the operating part is in the off position. The on-locking element is configured to maintain the operating part in the on position. At least a portion of the on-locking element is accommodated inside of the housing so as not to be operable when the operating part is in the off position. The portion of the on-locking unit is positioned outside of the housing such that the on-locking unit becomes operable when the operating part is in the on position.
US11938600B2
A tool having gripping jaw teeth that provide a contact pattern for engaging fasteners on-axis. The gripping teeth are formed in a depression disposed at a distal end of a jaw and are oriented at an angle that turns away from a major axis of the tool or an axis that is orthogonal to a plane formed by a front face of the jaw to increase the gripping force that can be applied to the fastener before the tool disengages or “slips against” the fastener.
US11938598B2
Position sensing related to a component within a power tool. The component within the power tool is, for example, a hammer of an impact mechanism and can include one or more sensible features that allow a controller of the power tool to precisely determine the position, speed, and acceleration of the component. One or more sensors can be used to determine the rotational position of the hammer and the axial position of the hammer. The rotational position of the hammer can then be used to calculate, for example, rotational speed and acceleration of the hammer. With precise determinations of the rotational and axial position of the hammer, the controller of the power tool is able to precisely time the impact between the hammer and the anvil to optimize the impact between the hammer and the anvil (e.g., to maximize energy transfer between the hammer and the anvil).
US11938594B2
An impact tool includes a housing including a motor housing portion and a front housing coupled to the motor housing portion, a motor supported within the motor housing portion, a battery pack supported by the housing for providing power to the motor, and a drive assembly supported within the housing and configured to convert continuous torque from the motor to consecutive rotational impacts upon a workpiece capable of developing at least 1,700 ft-lbs of fastening torque. The drive assembly includes a camshaft driven by the motor for rotation about an axis, an anvil extending from the front housing, and a hammer configured to reciprocate along a travel portion of the camshaft between a rearmost position and a forwardmost position to deliver rotational impacts to the anvil in response to rotation of the camshaft.
US11938592B2
Embodiments of this disclosure provide a method and apparatus to inject an abrasive fluid mixture into a high-pressure fluid flow using a clear fluid pump. The high-pressure fluid flow may be used in abrasive jet perforating and hydraulic fracturing applications in oil and gas wells, and other oilfield related work that uses high pressure fluids containing abrasive material. The embodiments include inserting abrasive material downstream of a high-pressure pump, such that a pump without specialized capability for abrasives (e.g., a clear fluid pump) can be used instead of a specialized pump that can withstand abrasives (e.g., hydraulic fracturing pump, oilfield cementing pump).
US11938591B2
A shot blasting cabinet with adjustable impellers includes a cabinet, a plurality of impeller apparatuses, and a plurality of adjusting devices. A shot-blasting working line is defined between an inlet and an outlet of the cabinet. The impeller apparatuses are symmetrically disposed on upper and lower sides of the cabinet. Each impeller apparatus has a protective housing, a driving device, a pair of rotary plates, and a plurality of impeller blades. The driving device connects one of the rotary plates. The protective housing covers the pair of rotary plates and the impeller blades, and defines a shot-blasting exit surface. The shot-blasting exit surface communicates with an interior of the cabinet. The adjusting devices are used to adjust an angle and a distance of the shot-blasting exit surface relative to the shot-blasting working line.
US11938588B2
A control method of a grinding water flow rate during a double side grinding process. A double side grinder used includes a grinding wheel, a feed unit and a water supply device, wherein a water inlet is disposed on the feed unit. The control method includes: prepare for grinding and complete the installation of a workpiece according to an operation procedure of the double side grinder; during a process of double side grinding, the flow rate of the water inlet is set to decrease with the shortening of the teeth length of the grinding wheel, with the flow rate of the water inlet being set to have a linear relationship with the teeth length of the grinding wheel.
US11938578B2
The invention relates to an interchangeable milling adapter (20) for a work table (60), which comprises a receptacle (21) for a milling machine (70) and an angular adjustment (22). At the same time, an angular position (WP1, WP2) of the receptacle (21) in relation to the work table can be adjusted using the angular adjustment (22). Furthermore, a work table, a milling unit and their use for adjusting a milling machine are described.
US11938576B1
A system and method for threading a torque tube through an opening within a U-bolt and module rail device is described. The system and method provide aligned horizontal movement of the torque tube across an assembly frame resulting in the torque tube being threaded through a plurality of U-bolt and module rail devices. After the threading process is complete, the threaded U-bolt and module rail devices are secured in place on the torque tube to allow coupling of solar panels to the module rails.
US11938572B2
A method for continuously applying hardbanding to an oil and gas tubular or building up a worn oil and gas tubular that includes low heat input welding without compromising the mechanical properties of the tubular. The method includes preparation of the surface of the oil and gas tubular and applying a consumable wire to the surface. The consumable wire may be hardbanding or buildup material with a hardness that is similar to the hardness of the oil and gas tubular.
US11938563B2
An annealed workpiece manufacturing method of irradiating a workpiece with laser light and annealing the workpiece includes a support step of supporting the workpiece, and an irradiation step of irradiating the supported workpiece with the laser light. In the support step, at least in a laser light irradiation area for the workpiece, the workpiece is supported by a cam member whose upper end height position is adjusted according to a rotation position.
US11938558B2
A double-action friction stir joining system, which includes a double-action friction stir joining device, a cleaning mechanism having a dressing member, a robot, and a control device. The double-action friction stir joining device includes a first rotary driver configured to rotate a pin member and a shoulder member, and a tool driver configured to reciprocate the pin member and the shoulder member. The control device is adapted to (A) operate the tool driver so that the pin member is thrusted into the shoulder member, (B) operate the first rotary driver so that the shoulder member rotates, and (C) operate the robot so that the robot holds the double-action friction stir joining device and the dressing member contacts an inner circumferential surface of the shoulder member.
US11938557B2
An ultrasound sonotrode (101), the first end of which is adapted to be connected to a mechanical vibrations source, equipped with a working tip (105,205,405,805) at the opposite end of the sonotrode (101), equipped with a body (104) with a cooling jacket (103), sealed at the place of contact with the body (104) of the sonotrode (101) with the use of the first seal (106) and the second seal (107), characterized in that according to the invention the first seal (106) is placed at a distance less than or equal to 20 mm from the node of the standing wave excited in the sonotrode in the working conditions, and the second seal (107,207,407,507,607) is equipped with a resilient element (108,208,408,508,608) and is located at a distance less than or equal to 20 mm from the working tip (105,205,405,805). A method for metal alloying, in which the material is melted on the working tip (105, 205, 405, 805) of the sonotrode excited to mechanical vibrations, according to the invention characterized in that a sonotrode according to the invention is used.
US11938555B2
A mechanical vibration machining apparatus or the like is suitable for forming a stable machined surface. A mechanical vibration machining apparatus performs machining of a machining target using a horn. A control unit instructs the horn to perform a mechanical vibration operation and a rotational driving operation. The control unit controls the mechanical vibration and/or the rotational driving in a periodic manner. For example, the control unit supports intermittent alternating control. That is to say, when one from among the mechanical vibration and the rotational driving is provided, the other is suspended. Such periodic control allows the stress that occurs due to the applied force to be dispersed, thereby allowing a stable machined surface to be formed.
US11938553B2
According to one implementation, a hole finishing tool includes a reaming cutter and a holder. The reaming cutter has a first detaching structure. The first flow path for ejecting cutting oil is formed inside the reaming cutter. The holder has a second detaching structure. The second detaching structure is detached from and attached to the first detaching structure. The second flow path for supplying the cutting oil to the first flow path is formed inside the holder. The holder has a shank. The shank is held by a tool rotating device. The holder has a sliding portion. The sliding portion has no back taper. The sliding portion is inserted into a positioning bush and slid inside the positioning bush. The sliding portion has a concave portion for storing lubrication oil.
US11938546B2
The present invention relates to a new type of metabolizable flower-like gold nanodandelion (GND), which possesses features: (1) large scale green synthesis with high monodispersity and a circa 100% yield; (2) cellular/physiological degradability; (3) precision control of the shape, petal number and size; (4) highly efficient radiotheranostics encompassing better enhanced CT contrast and pronounced x-ray induced ROS generation than conventional spherical AuNP.
US11938543B2
A silver sintering preparation in the form of a silver sintering paste comprising 70 to 95 wt.-% of coated silver particles (A) and 5 to 30 wt.-% of organic solvent (B) or in the form of a silver sintering preform comprising 74.5 to 100 wt.-% of coated silver particles (A) and 0 to 0.5 wt.-% of organic solvent (B), wherein the coating of the coated silver particles (A) comprises silver acetylacetonate (silver 2,4-pentanedionate) and/or at least one silver salt of the formula CnH2n+1COOAg with n being an integer in the range of 7 to 10, and wherein the at least one silver salt is thermally decomposable at >160° C.
US11938538B2
Provided is a method of producing a metal-plastic multi-layered hybrid structure by using laser three-dimensional (3D) printing, the method including printing a metal structure on a substrate by using a first laser, patterning an upper surface of the metal structure by using the first laser, printing a polymer bonding layer on the patterned metal structure by using the first laser, and printing a polymer structure on the polymer bonding layer by using a second laser having a wavelength longer than a wavelength of the first laser, wherein the printing of the polymer bonding layer includes forming an intermediate phase at an interface between the metal structure and the polymer bonding layer. A layered structure produced using the above method may include the intermediate phase having the effect of an oxygen inclusion connecting a metal and a polymer.
US11938537B2
A 3D printing system and methods to selectively pattern dense feedstock based on selective inhibition sintering (SIS). A sintering selectivity agent (inhibitor or promoter) is selectively deposited on a build layer according to the pattern boundary. When the layers are built-up and the part is sintered, the inhibited region remains unbound, thus defining the edge of the part. The material contain powder embedded in cohesive binder that make the adjacent layer adhere together. The build process involves forming the sheets of dense feedstock embedded binder, followed by depositing ink to promote selective sintering onto the layer. Once the build is complete, the process continues with the binder removal, sintering and finishing processes.
US11938525B2
A reaction kettle cleaning apparatus, includes a kettle body and a stirrer, the stirrer being located in the kettle body and including a stirring rod and a stirring portion, where a movable frame is disposed on the stirring rod and is movable along the stirring rod; and a cleaning device is disposed on the movable frame is configured to clean the kettle body; and the reaction kettle cleaning apparatus further includes a movable control apparatus configured to control the movable frame to move.
US11938524B2
A substrate processing apparatus includes a liquid processing tank, and a hydrophobizing gas supply unit. The liquid processing tank stores a processing liquid and dips a plurality of substrates in the processing liquid to liquid-process the plurality of substrates. The hydrophobizing gas supply unit supplies a gas of a hydrophobizing agent to the plurality of substrates after liquid processing thereof.
US11938514B2
Transducer assembly transmits ultrasonic energy towards a zone acoustically coupled to an object or area of interest, and comprises a piezoelectric subassembly matching a curved support layer disposed behind said subassembly. Piezoelectric subassembly comprises piezoelectric elements and metal connections. Piezoelectric elements are disposed along a first azimuth direction to form parallel curved segments of piezoelectric elements extending in a second elevation direction, each being in contact with a corresponding metal connection extending in the elevation direction for transmitting/receiving electric signals to/from each piezoelectric segment. The subassembly has a a central part comprising piezoelectric material and a lateral part comprising resin material incorporating the metal connections so that each curved segment results in a sequence of resin/piezoelectric/resin materials disposed along the elevation direction with the extension and curvature of the piezoelectric material in the central part defining the elevation focussing of the transducer assembly. A corresponding manufacturing process is also disclosed.
US11938510B2
A nozzle includes a pattern shim having a plurality of first slits and a plurality of second slits, an adhesive shim having a plurality of first holes, a gas shim, a head body having an adhesive outlet and an adhesive distribution groove communicating with the adhesive outlet, and a face plate. Adhesive ejection ports are formed at openings of the plurality of first slits, and gas discharge ports are formed at openings of a plurality of second slits in such a manner that the gas discharge ports are located on both sides of each of the adhesive ejection ports. The plurality of first holes communicate with the adhesive distribution groove. The plurality of first holes are formed in such a manner that distances of the first holes from the corresponding discharge ejection ports become shorter as distances of the corresponding first holes from the adhesive outlet become longer.
US11938507B2
Metering dispensers include a body configured to hold a flowable composition in a chamber, a drive screw coupled to the body, and a plunger threadingly coupled to the drive screw. The plunger includes at least two annular lips that form a fluid seal with the chamber as the plunger travels along the drive screw through the chamber. A base is rotationally coupled to the body with a cam that contacts at least one tab extending externally from the body so that the tab enters at least one low point on the cam by traveling over a trailing edge of the low point, and the trailing edge then prevents the tab from exiting the low point in the direction of the trailing edge.
US11938503B2
An ultrafine bubble (UFB)-containing liquid manufacturing apparatus includes a liquid ejecting unit having a thermal energy generating element, a flow path for leading liquid to the thermal energy generating element, a driving unit configured to drive the thermal energy generating element, and an ejection opening. The UFB-containing liquid manufacturing apparatus also includes a collecting unit configured to collect liquid ejected from the ejection opening. The driving unit drives the thermal energy generating element to cause film boiling in liquid led to the flow path and causes liquid containing ultrafine bubbles generated by the film boiling to be ejected from the ejection opening.
US11938500B2
A substrate processing apparatus includes: a substrate holder; a nozzle that ejects a processing liquid to the substrate; a conductive pipe that supplies the processing liquid to the nozzle; a ground line that connects the conductive pipe to a reference potential; a liquid receiver provided around the substrate holder and receives liquid ejected from the nozzle; and a deterioration degree measuring unit that measures a deterioration degree of conductivity of the conductive pipe. The deterioration degree measuring unit includes: a measurement liquid supply that supplies a measurement liquid to the conductive pipe; a potential difference imparting unit that imparts a potential difference between a liquid contact surface of the liquid receiver and the reference potential; and an ammeter that measures a current value of a current flowing through a charge moving path established via the measurement liquid between the liquid contact surface of the liquid receiver and the ground line.
US11938499B2
The present invention provides unique pressure actuated valves and related methods that may be used in applications where a plurality of fluid emission devices are provided on a plurality of lines containing fluid under pressure, in order to prevent fluid from escaping from the fluid emission devices until a consistent threshold or predetermined level of fluid pressure is obtained in the lines, without causing significant water pressure and/or flow loss through the valves. Valves of the present invention include a housing having an upper body and a lower body that may be coupled together to form an inner chamber, the lower body having an inlet in communication with a source of fluid under pressure, the upper body having an outlet in communication with a fluid emission device. A hollow movable fluid transmission piston is provided in the chamber for communicating between the inlet and outlet. The chamber formed between the upper and lower bodies may be provided with cup seals at opposite ends of the chamber to reduce friction and prevent fluid from entering therein, and a side air vent. A wider lower end of the piston is urged toward the lower housing body using a biasing mechanism, which pushes an O-ring at the lower end against a stop to prevent fluid from entering into the hollow center of the piston. When fluid with a sufficient pressure is provided from the source, it pushes the O-ring away from the stop and against the urging of the biasing member, allowing fluid to flow around the stop, through the center of the piston, and out through the upper body into the fluid emission device. The vent in the chamber allows air inside the chamber (surrounding the biasing mechanism) to escape so that there is no added air pressure within the chamber to be overcome by the fluid pressure.
US11938497B2
A fluid spraying system includes a fluid applicator having a tip that atomizes a fluid. The fluid spraying system also includes a pump configure to pump the fluid from a fluid source to the tip and a control system. The control system identifies at least one characteristic of the tip or the fluid and communicatively couples to the pump. The control system also controls an operating characteristic of the fluid spraying system based on a characteristic of the tip or the fluid.
US11938492B2
A nozzle for forming a spray pattern of micro droplets. The nozzle comprises a flow member having at least one face and a plurality of discrete grooves formed in the at least one face. One or more cover member is located over the face to cover the grooves so as to define a series of discrete channels. Each channel has a fluid inlet end that receives liquid to be sprayed and a fluid outlet end from which microdroplets are emitted.
US11938480B2
A microfluidic diagnostic device with a three-dimensional (3D) flow architecture comprises a polymeric body having first and second opposing surfaces and comprising first flow channels in the first opposing surface, second flow channels in the second opposing surface, and connecting flow passages extending through a thickness of the polymeric body to connect the first flow channels to the second flow channels, thereby defining a continuous 3D flow pathway in the polymeric body. The microfluidic diagnostic device also includes a first cover adhered to the first opposing surface to seal the first flow channels, a second cover adhered to the second opposing surface to seal the second flow channels, and one or more access ports in fluid communication with the continuous 3D flow pathway for introducing liquid reagent(s) and/or a sample into the polymeric body.
US11938477B2
A microfluidic cartridge is provided. The microfluidic cartridge has an interior and an exterior. The microfluidic cartridge includes a reservoir disposed in the interior of the microfluidic cartridge and configured to contain a fluid composition. The microfluidic cartridge includes an electric circuit disposed on the exterior of the microfluidic cartridge. The electric circuit comprises a first end portion having electrical contacts and a second end portion opposing the first end portion. The microfluidic cartridge includes a microfluidic die disposed on the exterior of the microfluidic cartridge, wherein the microfluidic die is electrically connected with the second end portion of the electric circuit and in fluid communication with the reservoir. A silicone pressure-sensitive adhesive is used to join the electric circuit with the exterior of the microfluidic cartridge.
US11938469B1
A transparent ceramic substrate is covered by a photocatalyst layer, at least partially. The photocatalyst layer includes a semiconductor material that, upon exposure to electromagnetic radiation, forms a plurality of electrons and a plurality of holes that remain confined to the photocatalyst layer. The transparent ceramic substrate has a diameter that is larger than the wavelength of the electromagnetic radiation for light trapping.
US11938467B2
The present invention provides a catalyst system for producing cyclic carbonates from carbon dioxide (CO2) and epoxide-based compounds comprising: a pre-catalyst; and a co-catalyst wherein said pre catalyst is BiCl3 and said co-catalyst is selected from tetra-n-butylammonium bromide (TBAB), tetra-n-butylammonium iodide (TBAI), tetra-n-butylphosphonium bromide (PBu4Br), tetra-n-butylphosphonium iodide (PBu4I) or mixtures thereof.
US11938466B2
Embodiments of catalyst systems and methods of synthesizing catalyst systems are provided. The catalyst system may include a core comprising a zeolite; and a shell comprising a microporous fibrous silica. The shell may be in direct contact with at least a majority of an outer surface of the core. The catalyst system may have a Si/Al molar ratio greater than 5. At least a portion of the shell may have a thickness of from 50 nanometers (nm) to 360 nm.
US11938462B1
A method of preparing an adsorbent can include pyrolyzing palm fiber to provide an palm fiber char, activating the palm fiber char, dissolving at least one polymer in an organic solvent to obtain a solution, dispersing the activated palm fiber char in the solution to provide a mixture, extracting the solvent from the mixture to provide a composite, and annealing the composite to provide the adsorbent. The adsorbent can be porous.
US11938461B2
The present description provides adsorbent compositions and materials, and systems comprising the same that provide low DBL bleed emission performance. The described materials provide unexpected production advantages as compared to currently available materials.
US11938460B2
The invention relates to novel composites for capture, e.g., absorption, of condensable gases and vapors from atmospheric sources, and gas or vapor streams, and the recovery of the condensed gases and vapors from the composites, as well as passive methods absent of external sources of energy for conducting the capturing and recovery processes. The composites include a hydrophilic matrix; hydrophilic solids embedded or immersed in the matrix, in close proximity to each other; and porogenic material embedded in the matrix, having a size larger than the hydrophilic solids; wherein selective removal of the porogenic material from the matrix forms a hierarchically porous matrix.
US11938459B2
Processes for removing arsenic compounds from a feed stream using an adsorbent in disclosed. The process includes contacting a feed stream comprising at least arsenic and sulfur compounds with an adsorbent comprising an low-crystallinity manganese oxide, at least one halide and a binder, to provide a treated effluent substantially free of the arsenic and sulfur compounds.
US11938447B2
An injector is provided to inject an aqueous urea solution into an exhaust line. The injector comprises a single fluid inlet, an injection passage, fluidly connecting the inlet to the injection port, and a shut-off device for the injection port. The shut-off device further comprises an actuator that is configured to selectively move a shutter between open and closed positions. A cooling passage is fluidly connected to the injection passage and is configured to cool the actuator. A fluid pressure regulator is interposed in the cooling passage.
US11938436B2
A vent filter (1), preferably for a pure liquid storage tank, comprising a cylindrical shell (2), at least one compartment (A) for accommodating granular filter material (3), said at least one compartment (A) defined between an inner peripheral surface (4) of the shell (2) and a pair of spaced apart separator plates (5) arranged in the shell (2) such that the spacing of the separator plates (5) in the axial direction of the shell (2) can be changed and fixed so as to apply a pressure on the granular filter material (3) in the at least one compartment (A). An air inlet (6) and an air outlet (7) are respectively arranged to allow a flow of air through the granular filter material (3) in the at least one compartment (A).
US11938432B2
An air cleaner assembly is disclosed, along with related methods. In one aspect, the air cleaner assembly has a housing including a housing body and a removable cover that together define an interior volume for holding a filter cartridge. The housing can include a first part of a first connection arrangement. The air filter cartridge can include a second part of the first connection arrangement. In one aspect, the first and second parts can be secured together place the air filter cartridge in a latched position by moving the air filter cartridge in a first direction. In one aspect, the first and second parts can be disconnected from each other to place the air filter cartridge in an unlatched position by moving the air filter cartridge in the first direction. The air cleaner assembly can include a second connection arrangement securing the air filter cartridge to the housing cover such that the housing body and housing cover are secured together.
US11938419B2
The present invention relates to a method and/or device for improving the separation behaviors and performance of aqueous two-phase system (ATPS) for the isolation and/or concentration of one or more target analytes from a sample. In one embodiment, the present method and device comprise ATPS components within a porous material and one or more phase separation behavior modifying agents that improve the separation behavior and performance characteristics of ATPS, including but not limited to the increasing the stability or reducing fluctuations of ATPS thought the adjustment of total volume of a sample solution that undergoes phase separation, volume ratio of the two phases of the ATPS, fluid flow rates, and concentrations of ATPS components.
US11938414B1
Systems, apparatuses, and methods for microfluidic fluid evaporation using femtosecond laser-patterned surfaces are disclosed. A microfluidic device may comprise a femtosecond laser-patterned substrate having at least one input path and at least one output path. The femtosecond laser-patterned substrate may comprise both superhydrophobic and superhydrophilic sections. Fluid deposited at an input path may be wicked to an output path due to the surface pattern. A heating device may be provided to heat the fluid to evaporate volatiles therefrom. Vacuums and gas streams may be used to aid in volatile removal. Gas streams may add gas to the microfluidic device to react with the fluid.
US11938412B2
A spinner toy with operational autonomy from an outside energy source, increased duration of rotation, and improved entertainment qualities is described. A rotating element of a spinner toy is configured to be centrally balanced relative to a central axis of rotation and is equipped with a means of rotation in the form of a ball bearing and screw converter having a housing in the form of a hollow sleeve, which is capable of converting the reciprocating motion of a pusher of the means of rotation into unidirectional rotational motion without slowing the rotating element. The present method includes imparting rotation to the rotating element without interrupting the use of the spinner toy by a user by means of mechanically converting the reciprocating motion of the pusher of the means of rotation in the form of a ball bearing and screw converter into unidirectional rotational motion without slowing the rotating element.
US11938410B2
A light filed (LF) display system for displaying holographic content to viewers in an amusement park (e.g., as part of an amusement park ride). The LF display system in an amusement park includes LF display modules tiled together to form an array of LF modules. In some embodiments, the LF display system includes a tracking system and/or a viewer profiling module. The tracking system and viewer profiling module can monitor and store characteristics of viewers on the amusement park ride, a viewer profile describing a viewer, and/or responses of viewers to the holographic content during the amusement park ride. The holographic content created for display on an amusement park ride can be based on any of the monitored or stored information.
US11938399B2
Systems and methods for tagging content of shared cloud executed mini-games and tag sharing controls
Methods for tagging content in a video game title during game play executed on a game cloud system, and social sharing methods. One method includes receiving a pause indication during the game play and suspending the game play to hold the video game title in a current frame image, storing the game state, and receiving the tag data that is associated to a location in the current frame image and to a user identifier for the current frame image. The method further includes generating a video recording of the game play having the tag data and generating a mini-game from a portion of the video game title. The mini-game includes a playable portion to enable view of a portion of the video recording for the mini-game and an executable portion to enable the play of game code for the mini-game that is a portion of the video game title.
US11938392B1
A bar jack device incorporated with a bottle, specifically a water bottle, is disclosed. The bar jack device may be part of the bottle lid or may be a separate add-on component that may be coupled to the bottle lid. The bar jack device may have one or more grooves designed to receive the central shaft of an exercise bar and orientate such bar in different orientations. The different created orientations of the exercise bar by the bar jack device may allow a user to load or unload weight plates on the sleeves of the exercise bar. Method of use of the bar jack device incorporated with the bottle to make a bar jack assembly is also disclosed. Among other things, the method of use lifts the exercise bar and the weight plates off the ground by using the bar jack device incorporated with the bottle as a pivoting mechanism.
US11938383B2
Described herein is a golf club head that comprises a body and a strike plate. The body comprises a heel portion, a sole portion, a toe portion, and a top portion. The strike plate comprises an outer peripheral edge and at least a portion of a strike face. Furthermore, the strike plate is welded to the body via a peripheral weld between the outer peripheral edge of the strike plate and the body. The outer peripheral edge of the strike plate comprises at least one welded portion, welded to the body via the peripheral weld, and at least one non-welded portion, not welded to the body.
US11938379B2
Golf balls having cores with increased hardness gradients are provided. The cores have an increased “positive” hardness gradient (or a “hard-to-soft” hardness) where the outer surface of the core is harder than the center. The increased positive hardness gradient can be achieved by introducing a water-releasing agent into the core rubber formulation during the curing process. The resulting golf balls have reduced spin and sufficient impact durability.
US11938378B2
In a golf ball having a core, envelope layer, intermediate layer and cover, the core has a specific hardness profile, the resin materials making up either or both of the envelope layer and the intermediate layer has a material hardness on the Shore D hardness scale of at least 65 and has a specific gravity of at least 1.05, and the Shore C hardness relationships among the core center, surface of the envelope-encased layer and surface of the intermediate layer-encased sphere satisfy the following conditions: surface hardness of envelope layer-encased sphere
US11938370B2
Disclosed is an exercise device having a platform and a roller. The platform has a surface sized and shaped to support a body part of a user and a pair of handles. The roller is coupled to the platform and configured to rotate relative to the platform. The platform is configured to translate in a first direction when the roller rotates in a first direction of rotation and translate in a second direction when the roller rotates in a second direction of rotation.
US11938358B2
A valve assembly includes a pipe fitting through which a gas is configured to flow. The inlet of the pipe fitting is configured to connect to an open port of a fire suppression sprinkler system so that gas flows from the fire suppression sprinkler system into the pipe fitting. The valve assembly also includes a vent valve. The inlet of the vent valve is connected to the outlet of the pipe fitting. The vent valve is operable to move between an open position and a shut position. The valve assembly includes an inert gas analyzer and at least one vent port upstream of the inert gas analyzer. The inert gas analyzer is positioned to measure the inert gas content of gas flowing in front of the inert gas analyzer and through the vent port to an outside environment.
US11938352B2
A filtering mask assembly includes a housing including a fan and an outlet valve. A filter is releasably mounted onto the housing and is adapted to substantially follow a shape and contour of the housing to seal the housing. A face seal is interposed between the wearer's face and the housing to provide a resilient conformity to the wearer's face when the mask assembly is worn. The mask assembly defines an inner space between the mouth and nose of the wearer and an inner side of the mask assembly, and an intermediate space between the housing and the filter and an outer space separated from the inner space by an outer side of the mask assembly. The fan is positioned on a downstream side of the filter to draw air through the filter. The mask assembly prevents the breathing of any air which has not passed through the filter.
US11938347B2
The present invention relates to an ultrasound apparatus for efficiently applying ultrasound waves over a treated area by mechanically moving the ultrasound transducer over an area larger than the Effective Radiating Area (ERA) comprising: (a) an ultrasound transducer, connected by wiring, for dispersing ultrasound waves; (b) an electric actuator for spinning a crank, wherein a shaft is eccentrically attached to said crank for rotatably whirling said transducer in circles.
US11938337B1
A system and method for mind-body relaxation may include a plurality of vibration modules, a light-providing member, a controller, a relaxation substrate, a pillow member, a graphical user interface (GUI), and network connection circuitry.
US11938331B2
The present invention is related to an implantable medical device. The medical device comprises an implantable component having a receiver unit; an external charging module having a power transmitter unit; and a data module having a data transmitter unit. The units are configured to establish a transcutaneous communication link over which data and power is transmitted on a single frequency channel via a time interleaving scheme comprising successive frames each divided into at least two time slots, and wherein one or more of the time slots in each frame is allocated to the data transmitter unit, and wherein one or more of the time slots in each frame is allocated to the power transmitter unit, and wherein data and power are transmitted by the transmitter units during their allotted time slots.
US11938329B2
Implantable medical devices include circuitry positioned adjacent to header-related structures, rather than having the header and related structures sitting atop the position of the circuitry within a device housing. A circuit board within the device housing may be positioned adjacently to a lead bore of the header. Feedthrough conductors may extend from the circuitry to conductors of the header while being positioned adjacently to the circuit board. Lead frame conductors may extend to the electrical connectors of the lead bores while also being adjacent to the upper portion of the circuitry. Device height may be reduced by having the circuitry be positioned adjacent to one or more of the various header-related structures.
US11938328B2
A system and method for selecting leadwire stimulation parameters includes a processor iteratively performing, for each of a plurality of values for a particular stimulation parameter, each value corresponding to a respective current field: (a) shifting the current field longitudinally and/or rotationally to a respective plurality of locations about the leadwire; and (b) for each of the respective plurality of locations, obtaining clinical effect information regarding a respective stimulation of the patient tissue produced by the respective current field at the respective location; and displaying a graph plotting the clinical effect information against values for the particular stimulation parameter and locations about the leadwire, and/or based on the obtained clinical effect information, identifying an optimal combination of a selected value for the particular stimulation parameter and selected location about the leadwire at which to perform a stimulation using the selected value.
US11938327B2
A stimulation system for a patient is provided. The system comprises: at least one implantable device comprising at least one implantable antenna; and an external device comprising at least one external antenna, wherein the at least one external antenna transfers power to the at least one implantable antenna. The at least one implantable device delivers therapy to the patient. A patient attachment device or body covering positions the at least one external antenna relative to the patient.
US11938319B2
A magnet arrangement for a hearing implant device is described. A magnet case is contained within an implantable device and has a central case axis of symmetry that is perpendicular to the outermost surface of the implantable device. The magnet case is configured to be freely rotatable within the implantable device about the case axis of symmetry. An implant magnet is contained within the magnet case and consists of a single cylindrical magnet having a central magnet axis of symmetry perpendicular to the case axis of symmetry. The implant magnet is configured to be freely rotatable within the magnet case about the magnet axis of symmetry.
US11938316B2
Paddle lead including a lead body having a distal end, a proximal end, and a central axis extending therebetween. The lead body includes opposite first and second sides that extend between the distal and proximal ends. The paddle lead also includes electrodes disposed along the first side of the lead body that are configured to apply neurostimulation therapy within an epidural space of a patient. The electrodes are electrically coupled to conductive pathways that extend through the proximal end of the lead body. The lead body includes a flexible material a flexible material that is configured to flex when a fluid pressure is imposed on the lead body in the epidural space. The lead body is configured to have a non-planar contour that folds or curves about the central axis when experiencing the fluid pressure.
US11938315B2
An electrical stimulation system includes at least one electrical stimulation lead, each of the at least one electrical stimulation lead including a plurality of stimulation electrodes; and a processor coupled to the lead and configured to perform actions, including: directing delivery of at least one electrical pulse through at least one of the stimulation electrodes of the at least one electrical stimulation lead to tissue of a patient; and directing discrete or intermittent measurement of an electrical characteristic of the tissue using at least one of the stimulation electrodes of the at least one electrical stimulation lead during, and after, delivery of the at least one electrical pulse to the tissue of the patient.
US11938313B2
A system for deploying an electrode array at a target location through a hole formed in the patient's cranium. The system includes an array of electrodes attached to a substrate and an inserter attached to the substrate and/or the array of electrodes. The inserter, substrate and array of electrodes are configured into a first compressed state and are positioned within the lumen of a cannula. Using the cannula, the system is inserted through the hole, the cannula is then removed, and the inserter is used to transition the substrate and electrode array from the first compressed state to a second uncompressed state, thereby deploying the array of electrodes at the target location.
US11938312B2
Apparatus for securing a therapy delivery device relative to a burr hole and method for making same. In one embodiment, the apparatus includes a base for seating in or near the burr hole. The apparatus may further include a stabilizer that may be engaged with the therapy delivery device. The stabilizer may include a surface coating or treatment operable to enhance frictional engagement with the therapy delivery device.
US11938310B2
A gas removal apparatus and a method for removing gas bubbles from at least a part of a medical device disposed in an interior chamber of a gas removal apparatus. The gas removal apparatus includes an interior chamber, a filling surface, a first opening arranged at an end of the filling surface and that provides a first path into the interior chamber, and a second opening that provides a second path into the interior chamber. When the apparatus is arranged in a liquid receiving position, at least a portion of the at least the part of the medical device is disposed above an uppermost surface of liquid in the interior chamber, and when the apparatus is arranged in another position different from the liquid receiving position, the entirety of the at least the part of the medical device is disposed below an uppermost surface of liquid in the interior chamber.
US11938300B2
The invention relates to a device for the dosed dispensing of an infusion fluid, in particular for administering an infusion for a patient, comprising a fluid vessel for accommodating the infusion fluid, and comprising an infusion line which is arranged between the fluid vessel and a patient access during the use of the device, wherein the fluid vessel and the infusion line are connected to one another, and the infusion line is designed such that at least a sub-section of the infusion line has a predefined inner diameter and a predefined length, such that the amount of infusion fluid accommodated in the fluid vessel is dispensed to the patient access over a predetermined time period in a manner dependent on a predefined height at which the fluid vessel is arranged above the patient access.
US11938298B2
A kit including a packaging and an injection device is described. The injection device defines a positioning recess. The packaging includes a channel extending longitudinally to accommodate the injection device. The channel includes a first longitudinal wall, a second longitudinal wall opposing the first longitudinal wall, and a base wall extending between the first longitudinal wall and the second longitudinal wall. The packaging also includes a first handling recess defined by the first longitudinal wall and a second handling recess defined by the second longitudinal wall. The packaging also includes a positioning rib protruding from the base wall into the channel for insertion into the positioning recess of the injection device.
US11938291B2
A device for reducing pressure within a lumen includes a reservoir structured for holding a fluid therein, an injection port in fluid communication with the reservoir, a compliant body structured to expand and contract upon changes in pressure, and a conduit extending between and fluidly coupling the reservoir and the compliant body. The fluid may be a compressible or a noncompressible fluid.
US11938289B2
The present invention describes a method for performing a prostate surgical treatment, said method comprising: arranging a catheter 1 inside of a urethra of a patient and anchored against the bladder neck of the patient subsequent to the filling of the balloon stopper unit 5 with a fluid when the balloon stopper unit 5 is arranged inside of the bladder of a patient; said method also comprising injecting at least one anesthetic agent and adrenaline or injecting botulinum toxin (Botox) and/or penicillin to the prostate via the injection tube 9 and the hollow tip 10 at an intended position of the prostate. Moreover, the present invention also refers to a kit comprising a catheter 1 according to the present invention and one or more syringe(s) 1000 containing adrenaline and at least one anesthetic agent and/or at least a syringe 1000 or vial containing botulinum toxin (Botox) and/or penicillin.
US11938281B2
An apparatus for guiding an elongated flexible instrument comprises a variable-length support assembly. The variable-length support assembly includes a first end, a second end, a plurality of support member pairs, and a plurality of eyelets configured to receive the elongated flexible instrument. Each support member pair comprises a first support member linked to a second support member, and each of the plurality of eyelets is movably coupled to at least one of the plurality of support member pairs along a longitudinal central axis between the first end and the second end. The variable-length support assembly is configured to selectively transition from a compressed configuration to an expanded configuration along the longitudinal central axis, and the plurality of eyelets are adapted to support the elongated flexible instrument as the elongated flexible instrument is advanced along the longitudinal central axis. Each of the plurality of eyelets includes a tapered alignment member configured to contact a tapered alignment member of an adjacent eyelet to move the plurality of eyelets into alignment along the longitudinal axis as the variable length assembly transitions from the expanded configuration to the compressed configuration.
US11938273B2
An oxygen mask configured for CO2 sampling and oxygen delivery, the oxygen mask having an oxygen inlet, a nasal breath-sampling element and a breath sampling port configured to receive breath samples, sampled by the breath-sampling element, wherein the breath-sampling element is configured to reduce dilution of exhaled breath by the delivered oxygen.
US11938271B2
An endotracheal tube holder device is provided for securely holding an endotracheal tube to a patient during intubation. The tube holder device includes a support rail placed above a lip of a patient. An auxiliary clip is coupled to the support rail and slidably movable along the length of the support rail for holding an accessory device relative to the patient's face. The auxiliary clip includes both a horizontal accessory holder and a vertical accessory holder to releasably retain the accessory device horizontally and vertically, respectively. A tube fastener is coupled to the support rail and includes a tube holder base, an adjustment clip coupled to the tube bolder base for laterally repositioning the tube holder base along the support rail, and a securement tie. The securement tie may be wrapped around a portion of the endotracheal tube to secure the tube to the tube holder base.
US11938268B2
An apparatus for providing a supply of humidified pressurized breathable gas to a patient interface, the apparatus comprising: a flow generator configured to pressurize a supply of breathable gas; a humidifier configured to provide water vapour to humidify the supply of pressurized breathable gas; a heated tube configured to be connectable to the humidifier to heat and deliver the humidified supply of breathable gas to the patient interface; a sensor configured to measure a property of the humidified supply of breathable gas in the heated tube; a controller configured to control power provided to the heated tube and control operation of the flow generator; and a set of low pass filters coupled between the sensor and the controller and/or a set of high pass filters coupled between the sensor and ground.
US11938267B2
A respiratory treatment apparatus and method in which a leak is determined by using an averaging window. The window starts at the present time and extends back in time to a point determined according to a current one of progressively detected phase measures of a first respiratory cycle and a corresponding phase measure attributable to a preceding second respiratory cycle. In another aspect, a jamming index indicates whether the leak is rapidly changing. To the extent that jamming is high, the leak estimate used progressively changes from that using sliding breath-window averaging to a more robust and faster responding low-pass filter method, and adjustment of ventilatory support based on measures employing estimated respiratory flow is slowed down or stopped.
US11938260B2
An apparatus for guiding cannulation with a dialysis needle of an arteriovenous dialysis access graft subcutaneously implanted in a body of a subject. The guiding apparatus comprises an elongated body member comprising a base portion terminating in longitudinal edges, a distance between the longitudinal edges of the base portion being substantially equal to a lateral dimension of the aces graft, and an elongated tubular sleeve defining an pocket having a longitudinal dimension and a lateral dimension configured to receive the body member. The body member is adapted to be received in the pocket of the sleeve for securing adjacent the subcutaneous access graft such that the inner surface of the base portion is aligned with a cannulation point of the graft for guiding location of a needle insertion.
US11938251B2
A modular environment modification device receives different cores for performing different functions such as dispensing decontaminant agents. These cores are contained within a housing that can communicate with other like devices and with remote devices such as iOS or Android powered smart devices. Communication between multiple like devices provides the ability to accommodate spaces of varying size. Sensors within each device monitor the environment, sense temperature and pressure, the presence of certain pathogens, and sound. Sensed information is used by the device to make decisions, like suspension of the decontamination process. Sensed information is sent to smart devices which perform various interfacing or data collection functions.
US11938245B2
Cartilage fibers and implants made therefrom are disclosed, with and without cartilage particles. Methods for making the cartilage fibers and the implants containing them are also disclosed. The implants may be pre-shaped, may be reshapable and, when implanted in a cartilage defect, the implants have good shape retention, little swelling, completely fill the cartilage defect and resist migration from the defect upon irrigation.
US11938243B2
Mobile decontamination systems and microwave assisted decontamination methods for decontaminating a variety of contaminated surfaces disposed external to the system are disclosed. The systems and methods comprise treating the surfaces with benign chemical formulations followed by exposing to microwave irradiation for short periods of time to achieve at least 6-log reduction in biological contaminants including viruses and spores of B. anthracis, B. thuringiensis, and P. roqueforti. The formulations comprise a percarbonate and surfactant in water.
US11938230B2
A hemostatic material is described, which eliminates the risks of conventional chitosan-derived products, such as the onset of shellfish allergy and endotoxin contamination, can be used safely for more people, and has an antibacterial property and a hemostatic function that widely-used hydrogels lack, and a wound dressing containing the same. A hemostatic material containing cationized cellulose and a wound dressing containing the hemostatic are described. At least one of hydroxyl groups of the cationized cellulose is modified with —R2—N+(R3)(R4)(R5).X−, other hydroxyl groups of the cationized cellulose have —H, or —(CH2CH2O)m—H, R2 represents C1-6 alkylene, C2-6 hydroxyalkylene, —(CH2CH2O)1—, or a combination thereof, 1 represents 1 or 2, m represents 1 or 2, and X− may represent an anionic group.
US11938228B2
A device for delivery of a first therapeutic agent and a second therapeutic agent to a site in epithelial tissue includes a first layer having a first, freeze-dried polymeric matrix having first and second opposed surfaces, formed by a composition including chitosan, a hydration promoter, a particle adhesion inhibitor, and a particle aggregation inhibitor, and a plurality of first particles embedded within the first matrix so as to be directly surrounded by, and in contact with, the first matrix, the first particles containing the first therapeutic agent and having a coating around the first therapeutic agent, the coating including chitosan. The device further includes a second layer, adjacent to the first layer, having a second, freeze-dried polymeric matrix containing the second therapeutic agent, the first layer and/or the second layer is configured to be attached to the site in the epithelial tissue.
US11938226B2
The present invention relates generally to compositions and methods comprising abiotic, synthetic polymers with affinity and specificity to proteins. The synthetic polymers are an improvement over biological agents by providing a simpler, less expensive, and customizable platform for binding to proteins. In one embodiment, the compositions and methods relate to synthetic polymers with affinity and specificity to vascular endothelial growth factor (VEGF). In one embodiment, the compositions are useful for treating diseases and disorders related to the overexpression of VEGF. In one embodiment, the compositions are useful for treating cancer. In one embodiment, the compositions are useful for detecting VEGF levels from biological samples. In one embodiment, the compositions are useful for detecting overexpression of VEGF from biological samples. In one embodiment, the compositions are used to diagnose cancer.
US11938223B2
Drug delivery using bio-affecting drugs, particularly with shape changing drug delivery devices. Embodiments are included for depots for delivery of a therapeutic agent that change from an elongated state ex vivo to a coil in vivo where the agent is released.
US11938222B2
The present application relates to a pregabalin sustained release composition, comprising: (a) an active ingredient; (b) a matrix-forming agent; (c) a swelling agent; (d) a gelling agent; and optionally a filler. The pregabalin sustained release composition provided in the present application can rapidly swell in volume when exposed to aqueous medium until exceeding the dimeter of human gastric pyloric (13 mm). It thereby prolongs the gastric emptying time to increase the retention time of pregabalin in the stomach and enhances absorption of pregabalin in the small intestine and ascending colon. Moreover, the pregabalin sustained release composition provided herein achieves a sustained release for 24 h, which allows QD (once a day) administration, reduces administration number, and improves patient compliance.
US11938219B2
Given developing resistance of tumor cells to current chemotherapeutic and targeted therapeutic agents, novel cancer therapies with enhanced potency and specificity are substantially required. Applicant has provided herein extracellular nanoparticle vesicles that redirect immune effector cells towards cancer cells for killing. Relative to conventional immunotherapeutic antibodies with defined orientation and geometry for their distinct antigen-binding arms, antibodies displayed on spherical exosomes can promote formation of immunological synapses as well as enhanced efficacy to activate immune cells.
US11938214B2
A benefit agent delivery system whereby benefit agents can be delivered on demand and/or a variety of different benefit agents at different concentrations can be delivered from the same system. The benefit agent delivery system includes a microcell layer comprising a plurality of microcells, wherein the microcells are filled with a carrier and a benefit agent. The microcells include an opening, wherein the opening is spanned by a sealing layer comprising a polymer and metallic material. Application of an electric field across the microcell layer and the sealing layer results in the migration of the metallic material from the sealing layer and the creation of a porous sealing layer, allowing the benefit agent to be released from the benefit agent delivery system.
US11938212B2
Disclosed herein are skin care compositions, comprising vitamin E (e.g., alpha-tocopherol), a thiourea derivative of histidine (e.g., ergothioneine), a vitamin B3 compound (e.g., niacinamide) and/or a pyrrolidone carboxylic acid and/or a salt thereof (e.g., sodium PCA) as well as to methods of using these compositions.
US11938209B2
The various aspects presented herein relate to the cooling and flavor boosting compositions, and their use thereof.
US11938200B2
The present disclosure relates to magnetic resonance imaging (MRI) methods comprising (i) obtaining a baseline chemical exchange saturation transfer (CEST) MRI image of a patient, (ii) administering an effective amount of a non-nutritive sweetener to the patient, and (iii) obtaining one or more test CEST MRI image of the patient subsequent to the administering step (ii); wherein the step (i) and (iii) acquisition parameters are substantially the same. The non-nutritive sweetener may include a natural or artificial sugar alcohol, polyol, or combinations or derivatives thereof.
US11938199B2
The present invention is in the field of bioluminescence in biology and/or medicine. In particular, the invention provides imidazopyrazine derivatives, processes for preparation thereof, and their uses as luciferins.
US11938195B2
The present disclosure provides EBNA1 and LMP1 dual-targeting peptides and upconversion nanoparticles conjugates comprising the same useful as therapeutic and theranostic agents capable of targeting EBNA1 and LMP1 proteins present in Epstein-Barr virus infected cells, such as cancer.
US11938194B2
The invention provides modified heavy chain constant regions including a cysteine at position 295 by EU numbering and optionally at position 239 by EU numbering. These cysteine residues provide sites for conjugation to a drug or label. When both cysteines are present in a normal heterodimeric antibody format, there are four such sites per molecule of antibody allowing a stoichiometry of one molecule of antibody to four of drug or label. Selection of the cysteine at position 295 with or without cysteine at position 239 is advantageous over cysteines at many other positions due to ease of expression, stability and cytotoxicity.
US11938192B2
The present disclosure relates to the treatment of pathological conditions, such as cancer, with Antibody Drug Conjugates (ADCs). In particular, the present disclosure relates to administration of ADCs which bind to CD19 (CD19-ADCs).
US11938190B2
Disclosed is a formulation comprising at least two of Rheum palmatum, Chrysanthemum indicum and Sanguisorba officinalis extracts or prevalent molecules therefrom and a pharmaceutically acceptable carrier. Further disclosed is a formulation comprising one or more of Rheum palmatum, Chrysanthemum indicum and Sanguisorba officinalis extracts, or prevalent molecules therefrom in combination with acyclovir and a pharmaceutically acceptable carrier. Disclosed also is a method for treating herpesvirus infections by administering a formulation comprising extracts of Rheum palmatum, Chrysanthemum indicum or Sanguisorba officinalis extracts or prevalent molecules therefrom with or without an antiviral agent, such as acyclovir and a pharmaceutically acceptable carrier.
US11938188B2
One aspect of the invention provides a slurry comprising: a plurality of sterile ice particles having a largest cross-sectional dimension less than about 1.5 mm; and a biocompatible surfactant. Another aspect of the invention provides a slurry including: a plurality of sterile ice particles having a largest cross-sectional dimension less than about 1.5 mm; a biocompatible surfactant; and a foam comprising a plurality of gas bubbles. Another aspect of the invention provides a slurry including: a plurality of sterile ice particles having a largest cross-sectional dimension less than about 1.5 mm; and a biocompatible excipient. Another aspect of the invention provides a slurry including: a plurality of sterile ice particles having a largest cross-sectional dimension less than about 1.5 mm; and a lipolytic agent.
