US11352435B2
Anti-CD133 monoclonal antibodies having advantageous properties, products, compositions and kits comprising the monoclonal antibodies, methods (processes) of making the monoclonal antibodies and related compositions, as well as methods of using the monoclonal antibodies in analytical, diagnostic and therapeutic applications.
US11352427B2
The invention relates to an isolated immunoglobulin heavy chain polypeptide and an isolated immunoglobulin light chain polypeptide that bind to a protein encoded by the T Cell Immunoglobulin and Mucin Protein-3 (TIM-3). The invention provides a TIM-3-binding agent that comprises the aforementioned immunoglobulin heavy chain polypeptide and immunoglobulin light chain polypeptide. The invention also provides related vectors, compositions, and methods of using the TIM-3-binding agent to treat a disorder or disease that is responsive to TIM-3 inhibition, such as cancer, an infectious disease, or an autoimmune disease.
US11352426B2
The present disclosure relates to protein molecules that specifically bind to CD3, which may have at least one humanized CD3-binding domain. Such molecules are useful for the treatment of cancer. The protein molecule binding to CD3 may have a second binding domain that binds to another target. In one embodiment, multispecific polypeptide molecules bind both tumor antigen-expressing cells and the CD3 subunit of a T-cell receptor complex on T-cells to induce target-dependent T-cell cytotoxicity, activation, and proliferation. The disclosure also provides pharmaceutical compositions comprising the CD3-binding poypeptide molecules, nucleic acid molecules encoding these polypeptides and methods of making these molecules.
US11352422B2
Agents that specifically bind to an opioid receptor in a conformationally specific way can be used to induce a conformational change in the receptor. Such agents have therapeutic applications and can be used in X-ray crystallography studies of the receptor. Such agents can also be used to improve drug discovery via compound screening and/or structure-based drug design.
US11352404B2
Fusion molecules of a cytokine or portion thereof and a polypeptide which targets the fusion protein to phosphatidylserine, pharmaceutical compositions thereof, and methods for their use in targeting a cytokine or portion thereof to a pathological site and treating a disease or condition responsive to cytokine treatment are provided.
US11352402B2
The present invention relates to interleukin-4 receptor-binding fusion proteins. More specifically, the invention provides, in part, fusion proteins that include an interleukin-4 or interleukin-13 protein moiety joined to an anti-apoptotic Bcl-2 family member protein moiety.
US11352400B2
Fusion peptide comprising: i) an amino acid sequence as defined in SEQ ID No.: 1 or a related homolog having at least 90% identity with SEQ ID No.: 1 and having the ability of the sequence SEQ ID No.: 1 to inhibit the kinase-independent function of PI3Kγ, and ii) a peptide having the ability to penetrate a cell.
US11352399B2
The present invention relates to a fusion polypeptide that inhibits TLR1/2, TLR2/6, TLR7, TLR8 and TLR9 signaling pathways as well as Toll-like receptor 4 (TLR4) and TLR3, and a pharmaceutical composition for preventing or treating TLR pathway mediated diseases. The fusion peptide of the present invention has an excellent effect of inhibiting TLR4 and various TLR pathways and can be effectively used in preventing and treating various TLR pathway mediated diseases caused by the signaling pathways, such as autoimmune diseases, inflammatory diseases and degenerative neurological diseases, by inhibiting the TLR mediated immune responses.
US11352397B2
Described herein are methods and compositions relating to engineered curli fibers, e.g. CsgA polypeptide. In some embodiments, the methods and compositions described herein relate to functionalized biofilms.
US11352396B2
Antimicrobial peptides of general formula X0X1X2C X3X4X5CX6X7X8X9CYX10X11CX12X13 are provided. Also provided are certain formulations containing these peptides and methods of using these peptides for treating skin infections in an animal in need thereof.
US11352390B2
A peptoid compound, a nanometer carrier, a pharmaceutical composition, and use of the pharmaceutical composition in manufacture of a medicament for treatment of a disease related to human epidermal growth factor receptor 1 (EGFR). The peptoid compound includes: cysteine (Cys) subunit, 1,4-butanediamine (Nlys) subunit, piperonylamine subunit, β-alanine subunit and 1-naphthylamine subunit. The peptoid compound has high affinity and targeting effect to the EGFR protein, and high selectivity, and meanwhile has high medicament loading efficiency, no toxicity, and high safety.
US11352387B2
Disclosed are chemical compounds, the compounds for use in a method of treatment, particularly in a method of prophylaxis or treatment for cancer, a process for preparation of the compounds and pharmaceutical compositions comprising the compounds. The compounds may, in particular, be useful in the treatment of leukaemia, lymphoma and/or solid tumours in Homo sapiens. The compounds are derivatives of cordycepin (3′-deoxyadenosine) having a 2′ and/or 5′-amino-acid ester phosphoramidate moiety.
US11352386B2
The invention relates to a metallocene complex according to formula (I), wherein R1 is selected from C2-C10 alkyl, preferably C3-C10 alkyl, C6-C20 aryl, C7-C20 aralkyl groups, wherein R2 is selected from H, C1-C10 alkyl, and wherein R3, R4, R5 and R6 are independently selected from H, C1-C10 alkyl, C6-C20 aryl, or C7-C20 aralkyl groups and wherein R3 and R4, R4 and R5, or R5 and R6 can be connected to form a ring structure wherein M is selected from Ti, Zr and Hf, X is an anionic ligand to M. The invention also relates to a catalyst comprising the reaction product of the metallocene complex and a cocatalyst. Further the invention relates to a (co)polymerization process of olefinic monomers.
US11352380B2
The disclosure provides a method of obtaining an isolated phospholipid enriched krill composition. The method includes a) contacting a crude krill composition with an alcohol in an amount sufficient to provide a phospholipid enriched layer and a non-phospholipid enriched layer; b) forming a phospholipid enriched layer and a non-phospholipid enriched layer, wherein the phospholipid enriched layer is above the non-phospholipid enriched layer; c) isolating the phospholipid enriched layer and the non-phospholipid enriched layer; and d) removing the alcohol from the phospholipid enriched layer to provide an isolated phospholipid enriched krill composition.
US11352376B2
A complex of formula (I) wherein M is zirconium or hafnium; each X independently is a sigma ligand; L is a divalent bridge selected from —R′2C—, —R′2C—CR′2—, —R′2Si—, —R′2Si—SiR′2—, —R′2Ge—, wherein each R′ is independently a hydrogen atom or a C1-C20-hydrocarbyl .group optionally containing one or more silicon atoms or heteroatoms of Group 14-16 of the periodic table or fluorine atoms, and optionally two R′ groups taken together can form a ring; R2 and R2′ are each independently a C1-C20 hydrocarbyl group, —OC1-20 hydrocarbyl group or —SC1-20 hydrocarbyl group; R5 is a —OC1-20 hydrocarbyl group or —SC1-20 hydrocarbyl group, said R5 group being optionally substituted by one or more halo groups; R5′ is hydrogen or a C1-20 hydrocarbyl group; —OC1-20 hydrocarbyl group or —SC1-20 hydrocarbyl group; said C1-20 hydrocarbyl group being optionally substituted by one or more halo groups; R6 and R6′ are each independently a C1-20 hydrocarbyl group; —OC1-20 hydrocarbyl group or —SC1-20 hydrocarbyl group; each R1 and R1′ are independently —CH2Rx wherein Rx are each independently H, or a C1-20 hydrocarbyl group, optionally containing heteroatoms.
US11352375B2
A method of forming polymerization auxiliaries for a polymerization process may include combining an antifouling agent with a killer agent to form an auxiliary composition; and contacting the auxiliary composition with an alkylaluminum. An antifouling complex may be produced by combining an antifouling agent with a killer agent to form an auxiliary composition; and contacting the auxiliary composition with an alkylaluminum.
US11352373B2
A process for a continuous production of a boronic acid derivative and an apparatus of performing the process are disclosed.
US11352372B2
The invention relates to 4-(1-hydroxy-3,4-dihydro-1H-benzo[c][1,2]oxaborinin-3-yl)benzimidamide derivatives and their use in treating diseases and conditions of the skin (for example, Netherton syndrome, rosacea atopic dermatitis, psoriasis and itch) caused by abnormally high levels of protease activity (particularly of serine proteases such as kallikreins). In addition, the invention relates to compositions containing the derivatives and processes for their preparation.
US11352366B2
The present invention provides a 2-aminoquinazolinone derivative. The present invention is a compound represented by formula (1) [wherein X1 represents CR or N, X2 represents CR2 or N, X3 represents CR3 or N, Y represents an optionally substituted C6-10 aryl or optionally substituted 6 to 10-membered heteroaryl, Z represents an optionally substituted C6-10 aryl, RA represents a hydrogen atom, halogen, cyano, optionally substituted C1-6 alkyl sulfonyl, optionally substituted C1-6 alkyl, or optionally substituted C1-6 alkoxy, and R1, R2, and R3 independently represent a hydrogen atom, halogen, optionally substituted C1-6 alkyl, or optionally substituted C1-6 alkoxy] or a pharmaceutically acceptable salt thereof.
US11352365B2
The present invention is directed to a compound having Formula (I) and its enantiomer: wherein the definitions of n, R, X, Y and Y3, and Z are provided in the disclosure. The invention is also directed to pharmaceutical compositions of the disclosed compounds, as well as their use as opioid-like agonists in the treatment of pain.
US11352364B2
A method for preparing phthalocyanine nanospheres is provided, including: synthesizing an ionic phthalocyanine molecule of formula I according to a following chemical scheme: wherein M is Cu or Zn, X is Br or Cl, R1, R2, R3, and R4 are aromatic substituent groups; dissolving at least one ionic phthalocyanine molecule selected from the formula I in a solvent to form a solution; preparing a two-dimensional layer crystalline material with an opposite charge to the ionic phthalocyanine molecule; adding the two-dimensional layer crystalline material to the solution; heating the solution to evaporate a portion of the solvent to aggregate the ionic phthalocyanine molecule into phthalocyanine nanospheres between a film layer of the two-dimensional layer crystalline material; and separating the phthalocyanine nanospheres from the film layer of the two-dimensional layer crystalline material.
US11352361B2
The present invention relates to compounds of formula I that function as inhibitors of RET (rearranged during transfection) kinase enzyme activity: wherein HET, bonds a, b, c and d, X1, X2, X3, X4, R2, and R3 are each as defined herein. The present invention also relates to processes for the preparation of these compounds, to pharmaceutical compositions comprising them, and to their use in the treatment of proliferative disorders, such as cancer, as well as other diseases or conditions in which RET kinase activity is implicated.
US11352347B2
The disclosure is directed to dantrolene prodrugs, compositions thereof, and methods of their use in the treatment of disease.
US11352337B1
Provided herein are methods for converting CBD to a product mixture comprising Δ8-THC, Δ9-THC, or a combination thereof. The methods provided herein may comprise one or more of (1) a contacting step wherein a starting material comprising CBD, a catalyst comprising a zeolite, and optionally a solvent are added to a reaction vessel, thereby forming a reaction mixture; (2) a conversion step wherein at least a portion of the CBD is converted to THC, thereby forming a product mixture; and (3) optionally, a separation step wherein at least a portion of the catalyst is removed from the product mixture. Advantageously, the methods do not require the use of catalysts or other reagents that are hazardous to human health.
US11352336B2
Disclosed is a cost-effective process for catalytic conversion of simple C6-based sugars (such as glucose and fructose) and industrial-grade sugar syrups derived from starch (such as different grades of High Fructose Corn Syrup) and cellulosic biomass to 5-HydroxyMethylFurfural (5-HMF) in a continuous-flow tubular reactor in bi-phasic media using inexpensive heterogeneous solid catalysts. Commercial and synthesized heterogeneous solid catalysts were used and their activities in terms of sugar conversion and HMF selectivity and yield were compared. Continuous dehydration of fructose, glucose and industrial-grade sugar syrups derived from corn and wood to HMF was achieved and the stability of selected catalysts and feasibility of catalyst recycling and regeneration were demonstrated. The performance of the catalysts and reactor system were examined under different operating conditions including reaction temperature, feeding flow rate, initial feedstock concentration, catalyst loading, presence of extracting organic solvent and phase transfer catalyst and aqueous to organic phase ratio. At the best operating conditions, HMF yield attained 60%, 45% and 53%, from dehydration of fructose, glucose and HFCS-90, respectively.
US11352335B2
The present invention provides an improved process for preparing 5-chloro-2-[(3,4,4-trifluoro-3-buten-1-yl)thio]-thiazole comprising reacting 2-[(3,4,4-trifluoro-3-buten-1-yl)thio]-thiazole with N-chlorosuccinimide (NCS) in the presence of water, the improvement comprising performing the step of reacting the compound of formula (II) with NCS in the presence of a reduced amount of water. The present invention provides an improved process for preparing 5-chloro-2-[(3, 4,4-trifluoro-3-buten-1-yl)thio]-thiazole comprising reacting 2-[(3, 4,4-trifluoro-3-buten-1-yl)thio]-thiazole with N-chlorosuccinimide (NCS) in the presence of water, the improvement comprising performing the step of reacting the compound of formula (II) with an excess molar amount of NCS.
US11352332B2
There is provided herein a compound of formula (I) wherein R1, R2, n, X, Q, L, m, R3 and p are as defined herein, which compounds are useful in the treatment of treatment of diseases characterised by impaired signalling of neurotrophins and/or other trophic factors, such as Alzheimer's disease and the like.
US11352331B2
Disclosed are a crystal of a 4-(naphthalene-1-yl)-4H-1,2,4-triazole compound (1) and a preparation method therefor, also comprised are applications of the crystal in preparing a medicament for treating an abnormal uric acid level-related disease.
US11352327B2
The present invention relates to a process for the preparation of compounds endowed with phosphodiesterase (PDE4) inhibitory activity having formula (I). The invention also relates to the process for the isolation by crystallization of the compound (I) and to its use for the preparation of pharmaceutical compositions for inhalation in combination with suitable carriers or vehicles. The present invention also relates to solvates and crystal forms of a compound of formula (I). The synthesized product is suitable for use in pharmaceutical applications for instance in the treatment of respiratory diseases.
US11352325B2
Reagents comprising MS active, fluorescent molecules with an activated functionality for reaction with amines useful in tagging biomolecules such as N-glycans and uses thereof are taught and described. In particular embodiments, the MS active, fluorescent molecules are of the compound of the Formula III or of the Formula IV where R1, R2 and R3 are defined herein.
US11352323B2
Provided herein are processes for making and methods of using salts of glycopyrronium, including solid forms and forms suitable for use as topicals. Disclosed here are processes for making salts of glycopyrronium, also processes for making compositions comprising salts of glycopyrronium, and methods of treating hyperhidrosis with salts of glycopyrronium as well as with compositions comprising salts of glycopyrronium such as, but not limited to, topical compositions. Disclosed herein are methods of treating hyperhidrosis including administering salts of glycopyrronium to subjects in need thereof.
US11352321B2
Provided herein are compounds, including enantiomerically pure forms thereof, and pharmaceutically acceptable salts or co-crystals and prodrugs thereof which have glucagon receptor antagonist or inverse agonist activity. Further, provided herein are pharmaceutical compositions comprising the same as well as methods of treating, preventing, delaying the time to onset or reducing the risk for the development or progression of a disease or condition for which one or more glucagon receptor antagonist is indicated, including Type I and II diabetes, insulin resistance and hyperglycemia. Moreover, provided herein are methods of making or manufacturing compounds disclosed herein, including enantiomerically pure forms thereof, and pharmaceutically acceptable salts or Co-crystals and prodrugs thereof. Formula I
US11352314B2
The present invention relates to compounds of formula (I) that are useful as perfuming ingredients of the fruity type. Formula (I) is in the form of any one of its stereoisomers or of a mixture thereof, wherein R1 represents a C1-3 alkyl or alkenyl group, R2 represents a methyl or ethyl group, R3 represents a C1-4 alkyl or alkenyl group, and the compound (I) has from 8 to 12 carbon atoms.
US11352309B2
Provided is a catalyst including a metal component including a first component that is rhenium and one or more second components selected from the group consisting of silicon, gallium, germanium, and indium and a carrier on which the metal component is supported, the carrier including an oxide of a metal belonging to Group 4 of the periodic table. Also provided is an alcohol production method in which a carbonyl compound is treated using the above catalyst. It is possible to produce an alcohol by a hydrogenation reaction of a carbonyl compound with high selectivity and high efficiency while reducing side reactions.
US11352301B2
The present invention relates to very high workable yet controllable concrete mix design, admixture composition, and process for placing concrete. The mix design relates to particular aggregate/cement ratios and types which are characteristic of ready mix concrete (RMC), which provide high fluidity reminiscent of self-consolidating concrete (SCC), and which provides advantages over both RMC and SCC in terms of ease and speed in placement and finishability at the construction site placement zone, regardless of whether into a horizontal formwork (e.g., for slabs, floors) or into vertical formwork (e.g., for blocks, walls, columns, etc.), without loss of control and without generating high risks of segregation even when small amounts of water are added at the size to facilitate finishing of the concrete surface. An inventive admixture combination which enables this unique design involves two different polycarboxylate comb polymers in combination with two specific viscosity modifying agents, and this combination provides highly workable concrete to be placed in a controlled, efficient manner.
US11352298B2
A cubic boron nitride sintered material includes: more than 80 volume % and less than 100 volume % of cubic boron nitride grains; and more than 0 volume % and less than 20 volume % of a binder phase. The binder phase includes: at least one selected from a group consisting of a simple substance, an alloy, and an intermetallic compound selected from a group consisting of a group 4 element, a group 5 element, a group 6 element in a periodic table, aluminum, silicon, cobalt, and nickel. A dislocation density of the cubic boron nitride grains is more than or equal to 1×1015/m2 and less than or equal to 1×1017/m2.
US11352297B2
The invention provides novel methods and novel additive compositions and use thereof in a wide range of concrete production for improving properties of concrete materials, such as durability and aestheticity. The methods and compositions of the invention may be applied in a variety of cement and concrete components in the infrastructure, construction, pavement and landscaping industries.
US11352293B2
A method of reworking lithium containing ion exchanged glass-based articles is provided. The method includes a reverse ion exchange process that returns the glass-based article to approximately the composition of the glass from which the glass-based article was produced, before being subjected to ion exchange.
US11352284B2
A system for urban organic solid waste pyrolysis-gasification coupled with drying includes a sludge feeding and storage device, a pre-drying device, a cyclone separator, a specific cloth bag for sludge and a flue gas waste heat recovery device sequentially connected. The cyclone separator and a sludge outlet of the specific cloth bag for sludge are connected with a cyclone fluidized bed gasification furnace. The cyclone fluidized bed gasification furnace is connected with a high-temperature separator. The high-temperature separator is connected with a secondary combustion chamber. High-temperature flue gas generated by the secondary combustion chamber serves as a heat source of the pre-drying device. Ash generated by the high-temperature separator and secondary combustion chamber is sent to an ash bin after being cooled by a cold slag conveyor. Through system integration and optimization, the disclosure adopts a two-stage process of pre-drying and pyrolysis-gasification, thus having high process controllability and operability.
US11352277B2
Wastewater treatment systems are disclosed. A wastewater treatment system includes a wastewater conduit disposed in a wastewater treatment vessel, a pump comprising an intake and an outlet connectable to the at least one opening of the wastewater conduit, and an adapter comprising a first end and a second end. The adapter is configured, in a treatment mode, to provide a flow path for wastewater from the wastewater treatment vessel through the adapter and pump to the wastewater conduit. The adapter is further configured to, in a backflush mode, provide a flow path for wastewater through the plurality of nozzles of the wastewater conduit and through the adapter and pump for discharge into the wastewater treatment vessel. Methods of treating wastewater using the system and adapter are disclosed. Methods of retrofitting a wastewater treatment system by providing the adapter are disclosed.
US11352269B2
A conventional media filter such as a gravity sand filter is converted into a membrane filter. The media is removed and replaced by immersed membrane modules. Transmembrane pressure is created by a static head pressure differential, without a suction pump, thereby creating a membrane gravity filter (MGF). Preferred operating parameters include transmembrane pressure of 5-20 kPa, 1-3 backwashes per day, and a flux of 10-20 L/m2/h. The membranes are dosed with chlorine or another oxidant, preferably at 700 minutes*mg/L as Cl2 equivalent per week or less. The small oxidant does is believed to provide a porous biofilm or fouling layer without substantially removing the layer. The media filter may be modified so that backwash wastewater is removed from near the bottom of the tank rather than through backwash troughs above the membrane modules. Membrane integrity testing may be done while the tank is emptied after a backwash.
US11352263B2
A solution and method of creating such for producing silicon nanowires or silicon nano-plates. The solution comprising distilled water, Potassium Hydroxide (KOH), at least one catalyst, Sodium Methyl Siliconate (CH5NaO3Si), Ethylenediaminetetraacetic Acid (EDTA), which act as a first chelating agent, Sodium Diethyldithiocarbamate (C5H10NS2Na), which acts as a second chelating agent, and Dimethylacrylic Acid, which acts as a buffer that is able to regulate the amount of silicon nanowires or plates formed and to prevent agglomeration. The concentration of the Sodium Diethyldithiocarbamate in the solution is greater than concentration of the EDTA in the solution for forming a plurality of thick and short nanowires, and the concentration of the Sodium Diethyldithiocarbamate in the solution is less than the concentration of the EDTA in the solution for forming a plurality of thin and long nanowires.
US11352250B2
A gas supply marine vessel and a refueling facility are described. The gas supply marine vessel includes a hull with an upper deck having an elongated cargo cavity formed therein. Gas interface modules are disposed in the cavity and extend between hull sides, each module having a plurality of fuel vessel docking stations. A plurality of stacked fuel container assemblies are fluidically coupled to the docking stations. A gantry, is movable along the length of the cavity, straddles the cargo cavity between hull sides. An articulating crane is mounted on the gantry and it utilized to move fuel container assemblies to a fuel container depression formed in the deck of a floating refueling facility. The floating refueling facility includes a concave side to facilitate mooring adjacent a shoreline, the concave side forming angled extensions at corners of the deck with a linkspan extending from each of the angled extensions.
US11352245B2
A beverage discharger may include a dispenser case; a channel body at least partially disposed in the dispenser case, the channel body having a first dispenser channel defined therein that communicates with a beverage discharge channel; a discharge body coupled to the channel body and having a second dispenser channel defined therein that communicates with the first dispenser channel, the discharge body extending vertically in an elongated manner; an ascending and descending body connected to the dispenser case in an ascending and descending manner; a shaft connected to the ascending and descending body to ascend and descend with the ascending and descending body, the shaft having, at a bottom portion, a packing that opens and closes the second dispenser channel; and at least one guide rib formed on an inner face of the discharge body to guide the bottom portion of the shaft.
US11352241B2
A cable tension overload fuse assembly is configured to couple together a structural support cable operatively coupled to a structural support, and a net barrier cable supporting barrier netting. The cable tension overload fuse assembly includes a mechanical fuse and a rescue cable coupled to the structural support cable and the net barrier cable. The mechanical fuse is configured to break upon exertion of a predetermined force to allow the net barrier cable to sag to reduce forces transmitted to the structural support and prevent damage to it, while the rescue cable continues to couple together the structural support cable and the net barrier cable to prevent the net barrier and/or net barrier or net barrier cable from falling completely to the ground without the structural support cable and cable tension overload fuse assembly.
US11352231B2
A controller includes a shaft control unit that controls driving of a shaft drive source such that a standby side roll is rotated, and a unit control unit that presses a pressing roller against an outer peripheral surface of the standby side roll via a sheet of a supply side roll by performing torque control on a unit drive source in a state in which the pressing roller is positioned in an area from a control switching position to the outer peripheral surface of the standby side roll together with performing position control on the unit drive source in a state in which the pressing roller is positioned in an area farther away from the standby side roll than the control switching position away from the outer peripheral surface of the standby side roll by a preset distance while the standby side roll is rotated by the shaft control unit.
US11352225B2
An image forming apparatus includes a stack portion on which a sheet is to be stacked, a regulating portion, a first detection device which includes a rotary variable resistor, a second detection, and a control unit. The regulating portion regulates a position of an edge of the stacked sheet. The first detection device outputs a detection signal based on the rotary variable resistor. The rotary variable resistor rotates in accordance with the sheet edge position regulated by the regulating portion. The second detection device detects presence or absence of the stacked sheet. The control unit calculates a calculated sheet width of the stacked sheet based on the output detection signal. The control unit sets the calculated sheet width after a first predetermined time has elapsed since the second detection device detects that the sheet is stacked on the stack portion as a detected sheet width of the stacked sheet.
US11352222B2
An assembly to distribute flowable particulate material, the assembly including: a conduit to which the material is delivered and to which an airstream is supplied to move the material along the conduit to a delivery downstream destination; material delivery means connected to the conduit for delivery of material to the downstream destination; control means operatively associated with the material delivery means to selectively deliver a pre-determined rate of the material to a separator to engage the airstream to concentrate the material in a portion of the airstream, the separator being positioned within the conduit upstream of the material delivery means; air distribution means in constant fluid communication with the separator and the material delivery means to control airflow to the material delivery means.
US11352219B2
A gripper arm for a gripping device for gripping, holding and guiding in particular bottle-like containers includes a base body, a gripping section as well as at least one actuating roller arranged on the base body and rotatably mounted for interacting with a control cam of the gripping device. The at least one actuating roller is arranged on the base body so as to be replaceable.
US11352203B2
A thief hatch assembly for a storage tank includes a housing and a cover that rests on an upper surface of the housing to seal and maintain a pressure within the storage tank. The thief hatch cover is configured to open at a predetermined set pressure to relieve excess pressure from the storage tank. The thief hatch assembly is attached to the storage tank using blind threaded mounting holes to prevent escape of gases from the storage tank through the mounting holes. In one embodiment, the blind threaded holes are provided in a flange adapter that mounts between the thief hatch housing and the storage tank. In another embodiment, the blind threaded holes are provided in a flange adapter that is welded to the storage tank. In another embodiment, the blind threaded holes are provided in the base of the thief hatch housing. Seals are provided between the mounting surfaces.
US11352200B2
A powder container (10) comprising a pressure vessel (12) for containing a quantity of powder (14) and a quantity of pressurised gas (32), an outlet through which, in use, the powder (14) can flow out of the pressure vessel (12), and an outlet valve (24) for selectively opening and closing the outlet, wherein the container (10) further comprises a data sensing and/or logging means (56, 58, 60, 62, 64) adapted to monitor and/or log various parameters of the powder (14) and/or the pressurised gas (32) and further comprising a control unit (54) adapted record and log the sensor readings either continuously, or at intervals, the control unit (54) comprising a communications module adapted to relay sensor readings, or log files, to a remote monitoring station.
US11352195B2
Heads for an aerosol container are disclosed. The head comprises a handle body having a base configured to be coupled to the aerosol container, an outlet, a flexible tube housed within the handle body. The flexible tube is configured to provide fluid communication between the container exit of the aerosol container and the outlet. And the head further comprises an elastically deformable actuator having a lever arm, and a coupling portion integrally formed with the lever arm and configured to be mounted around the flexible tube, wherein the coupling portion is further configured such that when the lever arm is deformed by a user, the coupling portion actuates on the valve body of the aerosol container. Aerosol containers having such heads and kits for treatments skin lesions are also disclosed.
US11352192B2
The invention relates to a device for pouring fluid (F) stored in a container (20) by inclining the container (20), the device (10) comprising: —a first part (100) comprising at least one collecting orifice (130) for collecting the fluid in the container (20), —a second part (150), which comprises fluid pouring means (160) that can be fluidically connected to the collecting orifice (130), —sealing means (190) separating the first part (100) and the second part (150), configured to seal the container when the device (10) is mounted on the container (20), the device being characterized in that the first part (100) also comprises a gas reservoir (110) and a degassing orifice (120) for evacuating gas from the reservoir (110) to the interior of the container (20).
US11352190B2
A machine for converting a sheet stock material into a relatively less dense dunnage product includes both (a) a helical pre-form assembly having a cylindrical mandrel with a longitudinal axis and a guide member for guiding the sheet stock material from a supply thereof into a helical path along and around the mandrel so as to form a helical pre-form that rotates around the longitudinal axis and advances parallel to the longitudinal axis; and (b) a restriction in the path of the pre-form that slows the advance and rotation of the pre-form past the restriction, the restriction causing the pre-form to retard longitudinal advancement, to twist upon itself, and to permanently deform as it moves past the restriction, thereby longitudinally and helically crumpling the pre-form.
US11352186B2
A shipping package and method of making a shipping package having a flexible inner sheet having a first surface and a second surface. The method includes providing one or more sheets of flexible material, joining the sheet(s) to form an article reservoir for accepting an article to be shipped, one or more expansion chambers, and an article retrieval feature. The expansion chambers can be inflated or otherwise expanded to provide structure to the package and to protect the article in the article reservoir.
US11352183B2
One-way pressure relief valves with wetting fluid reservoirs are disclosed. Valves of the types described herein may be applied to a product package, for example a package containing dry roasted coffee, to allow gas to escape from the package while preventing entry of ambient air into the package. A wetting fluid is provided within the valve to facilitate formation of the seal blocking entry of ambient air through the valve and into the product package. The wetting fluid reservoirs hold wetting fluid to limit or prevent leakage of the wetting fluid from the valve providing benefits such as improved application of the valves to the packages, improved retention of the valves to the packages, and appearance improvements resulting from avoidance of leakage of wetting fluid onto the valve and the package to which the valve is attached.
US11352178B2
A closure (40, 40A, 40B) for use with a container includes a body (54, 54A, 54B) defining a passage (72, 72A, 72B) and a first latch portion (92, 92B). The closure (40, 40A, 40B) has a lid (56, 56A, 56B) defining a deflectable press portion (96, 96A, 96B) that has a connection (100, 100A, 100B) to the closure body (54, 54A, 54B). The lid (56, 56A, 56B) has a cover portion (100, 100A, 100B) including a second latch portion (120, 120A, 120B) for engaging the first latch portion (92, 92B) to releasably hold the cover portion (100, 100A, 100B) in a latched closed position in which the cover portion (100, 100A, 100B) at least partially occludes the passage (72, 72A, 72B). The lid (56, 56A, 56B) has a biased hinge (104, 104A, 104B) connecting the cover portion (100, 100A, 100B) with the press portion (96, 96A, 96B) to accommodate movement of the cover portion (100, 100A, 100B) between the latched closed position and an unlatched open position.
US11352175B2
Safe and sealed closure method for the neck of a bottle, wherein the stopper (1) used and the container (2) to be closed are such that they form one integral part (5) upon closing of the container with the stopper via engagement by entry of a safety strip (6) of said stopper into a part (4) positioned on the container's neck such that the safety strip enters into the part of the container neck in one irreversible way, making the safety strip and the part one integral, non-detachable part or by entry of a safety strip positioned on the container's neck into a part of said stopper such that the safety strip enters into the part of the stopper in one irreversible way, making the safety strip and the part one integral, non-detachable part, wherein said safety strip or said part is attached to a safety seal band (8) of the stopper at an end of the safety seal band, wherein the safety seal band is attached to the whole circumference of the stopper when closed and wherein the safety seal band partially detaches from the stopper upon opening the bottle from opening points keeping the stopper attached to the container.
US11352159B2
Apparatus for extracting stacked articles from cardboard containers includes a store receiving the containers with a bottom closed by a tab; a rest and sliding plane substantially vertical and transversal to the store; a channel in a second unloading position, distant from the first pick-up position, for unloading the articles in the containers; abutting and folding means, lateral to the store near the first pick-up position for abutting and folding about the tab and opening the bottoms of the containers; an abutting plane substantially horizontal and transversal to the rest and sliding plane and lateral to the store between the first pick-up position and the unloading channel, to retain the articles inside the containers once the bottoms are open, and having an opening at the inlet of the unloading channel.
US11352153B2
Various embodiments of the present disclosure provide a strapping tool configured to tension metal strap around a load and, after tensioning, attach overlapping portions of the strap to one another by cutting notches into a seal element positioned around the overlapping portions of the strap and into the overlapping portions of the strap themselves.
US11352151B2
A system for transferring a fluid from a first spacecraft to a second spacecraft. The first spacecraft includes a fluid transfer system comprising: a pressurant supply system, a first fluid tank to store a fluid to be transferred, one or more transfer feedlines to provide fluidic connection between the first fluid tank and the second spacecraft, a connector for connecting the first spacecraft to the second spacecraft, an accumulator tank comprising a first portion connected to the pressurant supply system, a second portion configured in fluidic communication with the one or more transfer feedlines, and a flexible separator to separate the first portion and the second portion. The pressurant supply system supplies pressurant gas to the first fluid tank for pressurising the first fluid tank and to supply pressurant gas to the first portion of the accumulator tank for pressurising the first portion of the accumulator tank.
US11352150B2
A spacecraft structure for transporting propellant to be consumed by a thruster includes storing the propellant in the spacecraft in a solid state during at least a portion of a take-off procedure and supplying the propellant to the thruster in a liquid or vaporous state when the spacecraft is in space.
US11352146B2
A gas distribution assembly for providing gas to an actuator for opening an aircraft door and to an aircraft evacuation slide, the assembly comprising a single common gas supply and valve means for controlling distribution of gas from the common supply between the slide and the door actuator based on door opening position.
US11352137B2
Cargo load platform assemblies are especially adapted to provide support for a variety of cargo, such as auxiliary aircraft fuel tanks. According to certain embodiments herein, a load platform is provided which is adapted to being positioned onto a cargo deck of a cargo aircraft. At least one anti-rattle device is operatively associated with the load platform for positionally fixing the load platform to a tie-down ring of the cargo deck of a cargo aircraft. The cargo load platform may support a rigid fuel tank thereon so that auxiliary fuel tankage systems can be provided as may be needed.
US11352124B2
Continuous skin leading edge slats are disclosed. A disclosed example leading edge slat for use with an aircraft includes a single-piece nose skin defining upper and lower external surfaces of the leading edge slat, where the single-piece nose skin is to extend between a fore end and an aft end of the leading edge slat, and a box spar coupled to an inner surface of the single-piece nose skin. The box spar includes lateral walls extending away from the inner surface of the single-piece nose skin. The lateral walls define at least one compartment of the box spar.
US11352119B2
A linking part for an aircraft is disclosed having an elongated section including an internal longitudinal seat and a tenon mounted in the seat. The tenon includes a linking element at a free longitudinal end thereof and configured in a retracted position in which the tenon is fully inserted in the seat and does not create an obstruction, enabling the linking part to be easily moved towards the support element, or a deployed position (P2) in which the free longitudinal end of the tenon is outside the seat and is able to be linked using the linking element to the support element, thereby enabling a link to be made simply and quickly.
US11352118B1
A method for controlling propulsion of at least two marine drives on a marine vessel includes monitoring an engine output indicator for each of the at least two marine drives on the marine vessel and detecting whether the engine output indicator for a subset of those at least two marine drives is below an expected value. If so, then an output restriction is imposed on at least one remaining marine drive not in the subset of marine drives, wherein the output restriction reduces an engine output of the at least one remaining marine drive to a predetermined level.
US11352117B1
Apparatus and associated methods relate to configuring a watercraft propulsion system and control surface to generate a higher rate flow and a lower rate flow governed by the watercraft's yaw slip angle, adjusting the rate difference between the higher rate flow and the lower rate flow based on adjusting the yaw slip angle determined as a function of the control surface position and the propulsion system thrust vector, and directing by the watercraft the higher rate flow to converge with the lower rate flow to create a wave. The propulsion system may be a plurality of independently adjustable propulsion methods permitting propulsion system differential thrust vector adjustment. The control surface may be adjustable 360 degrees in the plane of the watercraft longitudinal axis. The yaw slip angle may be adjusted based on sensor information. Exemplary implementations may increase wave quality and improve maneuverability of a watercraft configured to create waves.
US11352106B2
Methods and apparatus are provided for deploying an unmanned marine vehicle into water, in which the unmanned marine vehicle includes a float and a glider connected by a tether. The apparatus includes a buoyant frame having a first frame arm, and a second frame arm spaced from the first frame arm to define a receiving bay between the first frame arm and the second frame arm, wherein the receiving bay is sized to receive the float. A glider retainer assembly is coupled to the buoyant frame and configured to releasably retain the glider. The apparatus further includes a payload deployment assembly having an attachment plate coupled to and positioned below the buoyant frame, and a payload compartment releasably coupled to the attachment plate by a payload release, wherein the payload compartment defines a receptacle sized to receive a payload coupled to the glider, and the payload compartment has a density greater than water.
US11352100B2
The present invention relates to a container transportation ship. More particularly, the present invention relates to a container transportation ship for transporting containers, characterized in that a loading space in which at least one container is loaded and a loading/unloading space configured such that an external transfer means can directly enter/exit in order to load and unload the container, are delimited on the deck of the container transportation ship; and a crane is provided to move the container in the longitudinal direction of the container transportation ship, in the transverse direction thereof, and in the upward/downward direction thereof for the purpose of loading the container on the external transfer means that has entered the loading/unloading space or unloading the container from the external transfer means.
US11352098B2
A method of assembling a floating wind turbine platform includes forming a base assembly of the floating wind turbine platform in either a cofferdam or a graving dock built in water having a first depth. The base assembly includes a keystone and a plurality of buoyant bottom beams extending radially outward of the keystone, wherein longitudinal axes of each of the plurality of bottom beams are coplanar. The cofferdam or the graving dock is flooded and the assembled base assembly is floated to an assembly area in water having a second depth. A center column and a plurality of outer columns are assembled or formed on the base assembly, a tower is assembled or formed on the center column, and a wind turbine is assembled on the tower, thereby defining the floating wind turbine platform.
US11352092B2
A vehicle including a front module including a front wheel and a rear module selectively moveably connected to the front module, the rear module including a rear wheel. The vehicle further includes an electric motor assembly, a mode selector, at least one extension assembly connected between the front module and the rear module for selectively extending and retracting to provide a selective variation in an overall length of the vehicle; and a vehicle control unit being communicatively connected between the mode selector and the electric motor assembly. The vehicle control unit performs a method for selectively changing the overall vehicle length. The method includes receiving from the mode selector an indication to change the overall length, determining that the front wheel is rotationally locked, and causing an electric motor to drive the rear wheel such that the rear module translates relative to the front module.
US11352088B2
In a vehicle mobile device mounting assembly and its auxiliary structure, the auxiliary structure is used with a vehicle mounting kit and mounted together on a rod-like portion of a bicycle. The vehicle mounting kit includes a fastening band. The auxiliary structure includes a fastening body, a joining portion integrally formed with the fastening body. The fastening body includes multiple fastening portions on its outer edges and a fastening space in the fastening body. Multiple fastening openings communicating with the fastening space are formed between the fastening portions. The auxiliary structure is mounted on the rod-like portion of the bicycle by inserting the fastening band of the vehicle mounting kit through a joining portion.
US11352085B2
A child bike seat includes a seat body having a seat shell for accommodating a child therein and a support structure for supporting the seat shell. The support structure includes two parts, with an edge portion of the seat shell disposed between the two parts of the support structure for holding the seat shell on the support structure. A method of assembling a child bike seat includes providing a frame part, arranging a seat shell for accommodating a child therein on the frame part, mounting a cover part to the frame part such that an edge portion of the seat shell is disposed between the frame part and the cover part.
US11352077B2
One general aspect includes a tethered temperature sensor (300) for use within a vehicle track (100). The tethered temperature sensor (300) includes one or more sensors (308) for measuring temperature located in a high strain and high temperature region (104) of the vehicle track (100). The sensor also includes circuitry (402) configured to control and/or monitor the one or more sensors and located in a low strain and low temperature region (102) of the vehicle track (100). The sensor also includes a housing (406) to contain the circuitry. The sensor also includes an encapsulating material (408) that fills an interior of the housing (406).
US11352068B2
A wheel-well closure system for a motor vehicle has a wheel-arch delimiting a wheel-well and a wheel mounted in the wheel-well, the system comprising: a support structure connected to the wheel-arch; and a cover connected to the support structure and covering the wheel-well; wherein the cover is made of a flexible material and is secured to the wheel arch; wherein the system comprises a continuous annular part secured to the wheel facing the cover and rotating with the wheel about a horizontal axis; and wherein the support structure comprises an arm extending radially in front of the continuous annular part and against the cover, a steering movement of the wheel about a vertical axis causing the continuous annular to push the support structure and stretch the cover outside the wheel-well.
US11352060B2
A method and a device generate haptic feedback for a vehicle driver, the haptic feedback being generated by applying an additional torque, which alternates about an average total steering torque, to a steering grip of a vehicle by way of an actuator. When the present haptic feedback is recognized and/or simultaneously when haptic feedback occurs, the actuator is actuated such that the magnitude of the average total steering torque is increased by a compensation torque.
US11352058B2
A vehicle traveling controller according to the present disclosure performs automatic steering so that a vehicle travels along a target path. The vehicle traveling controller allows a driver to intervene in steering. When the driver intervenes in steering and thereby a traveling position of the vehicle deviates outside from a threshold line set apart from the target path in a lane width direction, the vehicle traveling controller increases a steering reaction force acting on steering operation by the driver.
US11352057B2
A dual path agricultural machine including a control system having a number of input sensors, status sensors, and output sensors, and a controller configured to operate the dual path machine in a stability control mode and a selective rear-steer engagement and actuation mode. In the stability control mode, the controller adjusts an actual drive output of the dual path machine according to data received from the input sensors and feedback received from the output sensors so as to reduce a difference between the actual drive output and a desired drive output. In selective rear-steer engagement and actuation mode, the controller engages rear-steer mechanisms with caster wheels of the dual path machine and actuates the caster wheels via the rear-steer mechanisms if a criterion is satisfied. The controller disengages the rear-steer mechanisms from the caster wheels or does not actuate the caster wheels if the criterion is not satisfied.
US11352054B2
A method of controlling a steer-by-wire steering system for motor vehicles is disclosed for the calculation of a resulting self-aligning torque of a feedback actuator in a manner which is dependent on an operating state (hands-on/hands-off). The method includes determining of a base self-aligning torque for a first operating state, in which there is hand contact by a driver on a steering wheel, determining a hands-off self-aligning torque for a second operating state, in which there is no hand contact by the driver on the steering wheel, determining a self-aligning speed of the steering wheel for the first operating state and for the second operating state, and determining the resulting self-aligning torque on the basis of the base self-aligning torque or the hands-off self-aligning torque, as a result of which the steering wheel rotates at the defined self-aligning speed into the defined position.
US11352053B2
A turning control device includes: a target steering angle calculation unit configured to calculate a target steering angle of a turning mechanism, based on a second steering angle of a steering mechanism; a steering angular displacement calculation unit configured to, when a third steering angle, the third steering angle being either a first steering angle of the turning mechanism or the second steering angle, is in a range from a maximum steering angle that the third steering angle can take to a first threshold steering angle, calculate a steering angular displacement of the third steering angle with the first threshold steering angle used as a reference; a steering angle correction value calculation unit configured to calculate a steering angle correction value according to at least the steering angular displacement; and a corrected target steering angle calculation unit configured to correct the target steering angle with the steering angle correction value.
US11352051B2
A method for operating a steering system for a motor vehicle, wherein the steering system has at least one steering lever and at least one electric motor for shifting the steering lever so as to cause a steering movement in the presence of a steering input, and wherein the electric motor is electrically connected to a current source via cabling. In doing so, it is provided that the electric motor is actuated and an electric current flowing between the current source and the electric motor is measured in order to check an electrical connection between the current source and the electric motor under the condition that there is no steering input present.
US11352050B2
A method is proposed for operating a steering system of a motor vehicle, in particular an electromechanically supported steering system. First, at least one first virtual magnet and one second virtual magnet are provided in the steering system of the motor vehicle. A virtual magnetic force exerted on each other by the multiple virtual magnets is determined. A setpoint force that is to be applied to a lower part of the steering system is estimated and an auxiliary force with which a servo motor of the steering system acts on the lower part of the steering system is determined from the specified virtual magnetic force and the estimated setpoint force.
US11352049B2
A control device (15) is equipped with a steering angle returning torque target value setting unit (30) which calculates a returning control amount target value (MapOut) based on a vehicle speed (Vs) and a turning angle (θb), and with a steering angle returning torque command signal calculation unit (31) which calculates a retuning control amount (RetOut) based on the retuning control amount target value (MapOut). The steering angle returning torque command signal calculation unit (31) is equipped with a rate limiter (36). The rate limiter (36) determines a change in the vehicle speed (Vs) from a vehicle speed sensor (19), and gradually increases or decreases the retuning control amount target value (MapOut) at a certain rate and then outputs the returning control amount (RetOut).
US11352048B2
A rotation detection device includes a rotation detection circuit, a step-up power supply circuit, a step-down power supply circuit, a first power supply path, and a second power supply path. The rotation detection circuit is configured to detect a rotation number of a motor that generates a torque applied to a steering mechanism of a vehicle, based on an electric signal. The electric signal is generated according to a rotation angle of the motor that is acquired through an in-vehicle sensor.
US11352046B2
A lever assembly (20) has a lever (24) mounted to a lever housing (22), a plunger (26), an auto-return housing (28) pivotable relative to the lever housing (22), a trigger mechanism (30) movable relative to the auto-return housing (28), and a yoke member (32) pivotable relative to the auto-return housing (22) independent of the auto-return housing. The trigger mechanism (30) is movable to an extended position in response to movement of the plunger (26) for engaging a cam element (12) of the steering column (10) for auto-return of the lever to a rest position. The yoke member (32) interacts with the plunger (26) when the plunger (26) pivots with the lever (24) to cause the yoke (32) to pivot toward an engaged position, and the yoke (32) interacts with the trigger mechanism (30) when the yoke (32) is pivoted to move the trigger mechanism (30) toward the extended position.
US11352045B2
A steering wheel damper may include a plate fastened to a hub of a steering wheel; one or more posts each having one side fixed to a surface of the plate and the other side extending perpendicular to the surface of the plate; a mass body spaced from the plate, attached to the other side of the post, supported by the posts, and having upper and lower portions configured as magnet bodies having different polarities; and an electromagnet made by winding a coil around a core fixed to the surface of the plate.
US11352044B2
A steering handle for a steering apparatus of a motor vehicle includes an end face which faces a user when the steering handle is in a position of use and a display element arranged on a side of the steering handle which faces away from the end face. A control device carries out a method by which a position of the steering handle is changed based on a driving mode set by a driver assistance device. The control device generates an adjustment signal to change between a position of use of the steering handle and a position of rest of the steering handle. When the steering handle is in a position of rest, a surface of the steering handle which faces away from the user when the steering handle is in the position of use instead faces the user.
US11352036B2
A train activates an emergency brake when a Station Loop Coil (SLC) used for a stop-position determination function to determine whether the train has stopped at a stop target in a terminal becomes unable to be detected (non-detected state) before the train is determined to have stopped at a stop-position by the stop-position determination function after the SLC has been detected. Thus, the train can be prevented from colliding with a car stop disposed at an end of a track as a result of overrunning. In the terminal protection, an emergency brake or a service brake is activated also when a reception duration during which the SLC continues to be detected reaches a predetermined threshold time period, or when a traveling position of the train reaches a disposed position of the SLC but the SLC is not detected.
US11352035B1
The video monitoring system collects a video data stream in real time; the device inspection system collects and uploads an image of each electrical device along a line; the voice communication system realizes a voice call between an inspection staff and a back-end monitoring staff; the environmental monitoring system monitors a temperature, a humidity, and a water intake in the traction substation and each electrical device; the fire alarm system monitors a fire in the traction substation; the sulfur hexafluoride gas monitoring system monitors a sulfur hexafluoride gas leakage in an electrical device; the security prevention system collects alarm information; the power lighting monitoring system collects operation information of a power lighting device; the power monitoring system monitors an input current and voltage and an output current and voltage of the traction substation in real time. The information is transmitted to the railroad dispatching center.
US11352025B2
The present disclosure provides a method and system for controlling an unmanned logistics vehicle. The control method of the unmanned logistics vehicle comprises: when an unmanned logistics vehicle remains at a shipping location/pickup location, when a feature instruction of a user is recognized, the unmanned logistics vehicle is controlled to drive away from the shipping location/pickup location; and the feature instruction comprises at least one of a voice instruction, a limb action instruction, a fingerprint unlocking instruction and a facial expression instruction. The present disclosure increases the safety, efficiency, and intelligence of unmanned logistics vehicle operation, and enhances user experience.
US11352018B2
A method of operating a system for diagnosing software for a vehicle according to the present invention includes: generating a plurality of data sets including a function and an argument related to a diagnosis of target software executed in each of the plurality of cores; sequentially outputting the plurality of data sets to a shared memory; operating the target software according to the data set of the shared memory; and verifying the operation result in a verifying core.
US11352013B1
A vehicle device may execute one or more neural networks (and/or other artificial intelligence), such as based on input from one or more of the cameras and/or other sensors associated with the dash cam, to intelligently detect safety events in real-time. The vehicle device may further pass the input to a backend server for further analysis and the backend server can detect safety events based on the input. The vehicle device may analyze the output of the vehicle device and the output of the backend server to determine whether the output of the vehicle device is correct. If the output of the vehicle device is incorrect, the vehicle device can adjust how the vehicle device identifies safety events.
US11352011B2
An information processing system includes one or more vehicles, and a server communicable with the one or more vehicles. The vehicle acquires an image obtained by imaging a road on which a host vehicle is located. The vehicle or the server determines a degree of difficulty in traveling on the road due to snow cover from the image. The server stores the degree of difficulty in traveling for each of one or more roads, and provides information to a client by using the stored degree of difficulty in traveling for each of one or more roads.
US11352007B2
A brake/drive force control system includes: a requested acceleration calculating section; a powertrain control section calculating a minimum brake/drive force at the time of no fuel cut and a fuel-cut brake/drive force, generating larger one of a requested brake/drive force and the minimum brake/drive force when the requested brake/drive force is larger than the fuel-cut brake/drive force, and generating the fuel-cut brake/drive force when the requested brake/drive force is equal to or smaller than the fuel-cut brake/drive force; a brake control section generating a requested brake force; and a brake/drive force control section calculating the requested brake/drive force from requested acceleration, requesting the powertrain control section for the requested brake/drive force, acquiring the brake/drive force generated by a powertrain, and when the requested brake/drive force is smaller than the acquired brake/drive force, requesting the brake control section for a difference between the requested brake/drive force and the acquired brake/drive force.
US11352002B2
One or more techniques and/or systems are disclosed for automatically obtaining a profile for a set of accelerator pedal position sensors in a target vehicle. The profile can comprise a correlation of the position of the pedal to an output signal for one or more sensor in the set of sensors. A pedal position sensor signal reader can be used to automatically detect signals from one or more pedal position sensor in the target vehicle's accelerator pedal, while the pedal is released, depressed, and moving between the released and depressed positions. A pedal profile can be automatically generated using the output signals and corresponding pedal positions. Obtained data can be used to program a speed control device for the target vehicle. Correlated output can be used to adjust the speed of the vehicle by sending an emulated signal to the ECM, which may adjust the speed control system.
US11351988B2
A vehicle includes a set of sound sensors coupled to one or more processing systems that process sound data from the set of sound sensors in order to provide assisted driving features or functionality such as an emergency vehicle avoidance.
US11351982B2
Provided are a driving force control method and device for a hybrid vehicle, each capable of effectively absorbing torque fluctuation of an engine while suppressing deterioration in energy efficiency. The driving force control device for a hybrid vehicle comprises a PCM configured to: identify a speed reduction ratio in a driving force transmission mechanism; estimate an average torque output by an engine; estimate a torque fluctuation component of the torque output by the engine; set a countertorque for suppressing the estimated torque fluctuation component; and control an electric motor to output the set countertorque, wherein the PCM is operable, under a condition that the average torque output by the engine and an engine speed are constant, to set the countertorque such that, as the speed reduction ratio becomes smaller, the absolute value of the countertorque becomes larger.
US11351971B2
A system and a method for estimating the coefficient of friction of a hydraulic brake system in a motor vehicle. A system and a method for adjusting the braking torque of a hydraulic brake system in a motor vehicle in order to obtain a desired actual braking torque.
US11351970B2
Disclosed is a hydraulic control apparatus of a brake system including a modulator block having a motor bore, and a motor including a cover that covers an opening of a case accommodating a stator and a rotor and is supported on one side of the modulator block, wherein a vent hole for air flow between the inside and the outside of the motor is formed on the cover and a communication passage for communicating the motor bore and the vent hole is formed in the modulator block.
US11351955B2
The invention relates to a method of folding an airbag (10), especially an airbag (10) to be arranged beneath a vehicle roof (50), comprising an injection orifice (11), a guiding portion (13) arranged adjacent thereto in the longitudinal direction and an inflating portion (12) arranged adjacent to the guiding portion (13) in the longitudinal direction, the method including flatly spreading the airbag (10); laterally folding, especially zigzag folding, at least in portions at least one side part (30; 30′) of the airbag (10) in the direction of the longitudinal axis (L) of the airbag (10); furling the inflating portion (12) at least in portions starting from a trailing edge (26) of the airbag (10) that is maximally spaced from the injection orifice (11) in a first furling direction (AR) in the direction to the injection orifice (11); and forming the guiding portion (13) by laying at least one folding including a first folding bend (14) against the first furling direction (AR) so that the deployment behavior of the airbag (10) is influenced.
US11351952B2
The invention relates to a releasable retaining device (10) for a tether (16) of an airbag, comprising a retainer (12), a slit (14) for receiving the tether (16), a blocking member (18) made from metal which is displaceable between a blocking position in which it maintains the tether (16) blocked in the slit (14) and a release position in which the tether (16) is released, and comprising a pyrotechnical igniter (20) coupled to the blocking member (18) such that, upon activation of the igniter (20), the blocking member is displaced from the blocking position to the release position. Moreover, a housing (32) including a retaining device (10) for an airbag is provided.
US11351951B2
A vehicular airbag device capable of improving reduction of an occupant obstruction value during a diagonal collision. A vehicular airbag device opens an airbag door on an instrument panel. The outer shape of the airbag when fully deployed and expanded is line-symmetrical with respect to a center line of the opening in a vehicle left-right width direction, and a width dimension in the vehicle width direction at a position of a rear edge of the instrument panel in the vehicle longitudinal direction is greater than a width dimension in the vehicle width direction at a position of a center of the opening in the vehicle longitudinal direction which is more forward in the vehicle longitudinal direction than the rear edge position of the instrument panel.
US11351950B2
A vehicle seat for supporting an occupant in a sitting position includes a backrest, and an airbag unit. The airbag unit comprises an inflatable airbag provided in an initially rolled and/or folded airbag package, and an inflator actuable to direct inflating gas into the airbag to inflate the airbag into an inflated configuration. The airbag comprises a pair of inflatable chambers which are physically connected to one another via a connecting interface, and are fluidly isolated from one another. The airbag unit is mounted and configured such that, upon actuation of said inflator to inflate the airbag, the inflatable chambers inflate into respective deployed positions in which they: i) extend forwardly from respective opposing and laterally spaced-apart side regions of said backrest; and ii) extend upwardly, and laterally inwardly across an uppermost region of the seat towards said connecting interface, so as to thereby cooperate to define an inflated shroud around at least an uppermost region of the backrest so as to extend over the sitting position and provide lateral protection to a said occupant of the seat in the sitting position.
US11351949B2
A restraint system (10) for helping to protect an occupant (60) of a vehicle (20) having a seat (50) for the occupant (60) includes a primary airbag (70) having a stored condition within a roof (32) and being inflatable to a deployed condition aligned with the seat (50). A support airbag (76) has a stored condition within the roof (32) and is inflatable to a deployed condition engaging the primary airbag (70).
US11351942B2
A vehicle bumper assembly includes a single-piece sub-frame having at least one step portion. The sub-frame is structured to be mountable on an extended portion of a vehicle frame so that the at least one step portion resides directly above the portion of the vehicle frame.
US11351941B1
A system and method for managing customized vehicle settings across multiple vehicles is disclosed. The system comprises a vehicle customization platform where a user customization profile with information about customized settings can be transferred to a customization management system within each of multiple vehicles that may be driven by a user with the user customization profile. The customized vehicle settings include seat position settings, horsepower settings, mirror position settings, climate settings, and audio system settings. Upon receiving the user customization profile, a customization management system passes customized settings to different vehicle control systems to automatically set the customized settings.
US11351933B2
A vehicle banner assembly for displaying a banner on a vehicle includes a panel is comprised of a magnetic material to magnetically engage a ferromagnetic door of a vehicle. A pair of engagements is each coupled to the panel. Each of the engagements engages an upper edge of the door of the vehicle to retain the panel at a selected location on the door. A banner is coupled to the panel to facilitate the banner to be displayed on the door of the vehicle.
US11351931B2
A driver assist system for a vehicle includes a bracket connectable with a vehicle window. The bracket has a body portion and a camera viewing window in the body portion. A camera in the body portion has a field of view through the camera viewing window. A heat sink contacts the camera and is configured to contact the vehicle window. The heat sink extends about a periphery of the camera viewing window so that heat generated by the camera is transferred through the heat sink to an area of the vehicle window that surrounds the camera's field of view.
US11351923B2
A multi-layer bladder includes: a first bladder layer; a mask including a plurality of apertures; a second bladder layer bonded to the first bladder layer within the apertures in the mask and where the mask is not present between the first and second bladder layers, where the mask is configured to prevent bonding of the second bladder layer to the first bladder layer where the mask is present; and a fluid channel that is located between the first and second bladder layers and that extends to the mask from an outer edge of the multi-layer bladder.
US11351912B2
A vehicle headlight system that can be used together with a vehicle control unit (3) that switches from an autonomous driving mode to a manual driving mode on the basis of external information about a vehicle (1), wherein the system has a headlight (100) mounted on the vehicle (1), and a lamp control unit (4) that controls the headlight (100), the lamp control unit (4): controlling the headlight (100) so as to form a first light distribution pattern (P) when the vehicle control unit (3) is executing the autonomous driving mode; controlling the headlight (100) so as to form a second light distribution pattern (Q) when the vehicle control unit (3) is executing the manual driving mode; and controlling the headlight so as to form a third light distribution pattern (R) that irradiates at an illuminance equal to or greater than the illuminance of the first light distribution pattern (P) and/or irradiates a range equal to or greater than the irradiation region of the first light distribution pattern (P), when transitioning from the autonomous driving mode to the manual driving mode.
US11351907B2
Disclosed is a system for monitoring the water level proximate to a vehicle. The system comprises a control unit and at least one sensor in communication with the control unit. The at least one sensor is configured such that the control unit can determine a pitch of a trailer coupled to the vehicle and the height of a surface of water proximate to the trailer. The system includes a display screen displaying a representation of the trailer including the pitch of the trailer, and a representation of the surface of water proximate to the trailer.
US11351895B2
A vehicle seat including: a seat cushion configured to support buttocks and thighs of a seated occupant; a temperature changing section that is provided at the seat cushion and is switchable between a first state in which the temperature changing section operates so as to warm the seated occupant from a front end portion of the seat cushion, and a second state in which the temperature changing section does not operate so as to warm the seated occupant from the front end portion of the seat cushion and a control section configured to control the temperature changing section so as to alternate repeatedly between the first state and the second state in a state in which an occupant is sitting on the seat cushion.
US11351889B2
A method for controlling a fuel cell vehicle is provided. The method includes setting a target purge degree of an anode gas and a target opening degree of an air pressure control valve and determining whether a fuel cell stack is in a power generation stop state. When the fuel cell stack is in the power generation stop state, when the anode gas is purged from the anode based on the target purge degree and the target opening degree, whether hydrogen in the anode gas will flow backwards to a stack enclosure is determined. When the hydrogen flows backwards, at least one of the target purge degree and the target opening degree to a level at which the backflow of the hydrogen is prevented is modified, and the anode gas from the anode based on the modified target purge degree and the modified target opening degree is purged.
US11351887B2
Provided is a management device that manages a power storage module configured by connecting in series a plurality of parallel cell groups in which a plurality of cells are connected in parallel. In the management device, a voltage detection circuit detects a voltage of each of the plurality of parallel cell groups connected in series. A plurality of equalizing circuits are connected in parallel to the plurality of parallel cell groups, respectively. A controlling circuit controls the plurality of equalizing circuits based on the voltage detected by the voltage detection circuit and executes an equalizing process. The controlling circuit determines whether or not an abnormal cell is included in each of the parallel cell groups based on a voltage change of each of the parallel cell groups during discharging to the equalizing circuit or charging from the equalizing circuit.
US11351884B2
Power to the box systems and methods are provided herein. An example system includes a human machine interface of a vehicle, a power to the box system of the vehicle, and a controller having a processor and a memory, the processor executing instructions stored in the memory to determine actuation of a power to the box system of a vehicle, determine usage parameters of the power to the box system of the vehicle during a period of use extending from the actuation to a terminating event, generate a message that includes information indicative of the usage parameters; and transmit the message to a receiving party.
US11351881B1
The present disclosure relates to a multi-functional multi-ratio OBC/LDC integrated circuit that is capable of bidirectional operation over a broad voltage rage with a high power density and without additional control in a battery charging system for an electric vehicle. As the turns ratio can be used selectively, the G2V and V2G functions can be performed bidirectionally over a broad voltage range without additional control, and the LDC function can be operated by using only a small number of switches, so that the efficiency of the charging control can be increased.
US11351877B2
An electric vehicle charging equipment (EVSE) system is provided. The EVSE system delivers direct current (DC) charging power and is configured for delivering electrical energy to a single electrical vehicle at a same time. The EVSE system comprises a plurality of charging cables with respective charging connectors for connecting to a respective plurality of electrical vehicles. At least one of the plurality of charging cables is liquid cooled and each of the plurality of charging cables comprises at least two DC power lines and at least two signal lines, which are each connected to a respective DC power line within the charging connector. The EVSE system further comprises a DC metering device configured for measuring, via the at least two signal lines, a connector voltage between the at least two DC power lines within the charging connector.
US11351875B2
A multi-input charging system and a multi-input charging method using a motor driving system can promptly compulsorily discharge a high charging voltage formed in a neutral point capacitor forming a neutral point voltage in a charging process and formed in a DC capacitor between an inverter and a battery.
US11351863B2
An apparatus comprising an interface, a memory and a processor. The interface may be configured to receive sensor data samples during operation of a vehicle. The memory may be configured to store the sensor data samples over a number of points in time. The processor may be configured to analyze the sensor data samples stored in the memory to detect a pattern. The processor may be configured to manage an application of brakes of the vehicle in response to the pattern.
US11351857B2
In a sleeve member for a filler pipe, the filler pipe passes through the sleeve member internally and is positioned with an upper end thereof on a fuel supply portion formed on an outside panel forming an outside of an automobile through a through hole formed in an inside panel forming a wheel house of the automobile. The sleeve member includes an attachment portion relative to the outside panel; a main seal portion elastically deformed and pressed against an inner face facing a space formed between the inside panel and the outside panel in such a way so as to surround the through hole by an insertion into the through hole; and an engagement portion which becomes engageable with a hole edge portion of the through hole positioned on an outer-face side of the inside panel by the insertion into the through hole.
US11351856B2
The disclosure provides a work vehicle in which clogging of a filter of an air cleaner with snow can be suppressed. The work vehicle includes: a radiator that cools cooling water for an engine; an air cleaner that cleans air to be fed to the engine; and an inlet hose that has an aspiration port open on a rear side of the radiator and leads the air from the aspiration port to the air cleaner. The radiator includes a shroud having an opening in which a fan of the engine is disposed and the aspiration port is disposed not to overlap with the opening of the shroud in back view.
US11351852B2
The present disclosure discloses a trunnion mount for mounting an engine, in particular a combustion engine, to a chassis, comprising a support element rigidly connected and/or connectable to the engine having a ring portion with an outer bearing surface, which may be arranged concentrically around the crankshaft; a female support having an inner bearing surface for surrounding the bearing surface of the support element, the female support forming the link between the chassis and the engine; and a rubber bearing arranged between the inner bearing surface of the female support and the outer bearing surface of the support element. In one or more examples, the trunnion mount includes a rubber bearing that is directly vulcanized on at least one of the bearing surfaces and/or wherein the ring portion is formed as a separate element from a mounting portion of the support element and connectable thereto via axial screws.
US11351846B2
A lock system for operation of a roll top cover for covering a cargo bed of a vehicle enables a plurality of locking or engagement points. The system includes: one or more lock assemblies configured to operate a plurality of locking mechanisms for reversibly engaging the cargo bed; and an actuator assembly having an actuator operably connected to the lock assemblies for operation thereof between locked and unlocked positions.
US11351842B2
A transport refrigeration system (TRS) includes a first heat transfer circuit including a first compressor, a condenser, a first expansion device, and a cascade heat exchanger. The first compressor, the condenser, the first expansion device, and the cascade heat exchanger are in fluid communication such that a first heat transfer fluid can flow therethrough. The TRS includes a second heat transfer circuit including a second compressor, the cascade heat exchanger, a second expansion device, and an evaporator. The second compressor, the cascade heat exchanger, the second expansion device, and the evaporator are in fluid communication such that a second heat transfer fluid can flow therethrough. The first heat transfer circuit and the second heat transfer circuit are arranged in thermal communication at the cascade heat exchanger such that the first heat transfer fluid and the second heat transfer fluid are in a heat exchange relationship at the cascade heat exchanger.
US11351841B2
There is disclosed a transport refrigeration system comprising an electronically governed engine that drives a refrigeration circuit of the system. The engine control unit is configured to operate the engine in a droop mode of operation, in which the engine speed increases with decreasing engine loads from the refrigeration circuit, so as to maximise the cooling capacity of the system at low engine load conditions.
US11351840B2
Disclosed herein is an air conditioner for a vehicle, which can perform a bleeding function to discharge air to a rear seat floor vent in a rear seat vent mode, and optimize the size of an outlet and the shape of doors to adjust a bleeding amount of a rear seat floor. The air conditioner for a vehicle, which includes an air-conditioning case having an air passageway formed therein, and a heat exchanger for cooling and a heat exchanger for heating which are disposed in the air passageway of the air-conditioning case to exchange heat with air passing the air passageway, includes: a front seat temp door for adjusting the degree of opening between a front seat cold air passageway and a part of a warm air passageway; a first rear seat temp door arranged between the heat exchanger for cooling and the heat exchanger for heating to adjust the degree of opening of another part of the warm air passageway; and a rear seat mode door for adjusting the degree of opening of a rear seat air outlet, wherein the rear seat mode door has a rear seat closing function to close an air flow to a rear seat air outlet, and has a bypass part to bleed some of air.
US11351838B2
A thermal management system for a vehicle may include a cooling apparatus configured to include a radiator, a first water pump, a first valve, and a reservoir tank to circulate a coolant in the coolant line to cool at least one electrical component provided in the coolant line; a battery cooling apparatus including a battery coolant line connected to the coolant line through a second valve, and a second water pump and a battery module which are connected through the battery coolant line; a chiller provided in the battery coolant line between the second valve and the battery module, and connected to a refrigerant line of an air conditioner; and a heating circuit including a heater which is connected to the coolant line and the chiller through first and second connection lines to supply a coolant having a temperature which is increased while passing through the at least one electrical component.
US11351836B2
A stabilizer (1) for a chassis of a vehicle. The stabilizer has a curved stabilizer body (2) that forms a torsion spring, a pendulum support (5, 6) and a connecting element (7, 8). The connecting element (7, 8) connects the stabilizer body (2) and the pendulum support (7, 8) to one another. To reduce the cost and complexity of assembly. The stabilizer is characterized in that a first end (11) of the connecting element (7, 8) is injection-molded onto a pendulum support end (9).
US11351831B2
An electrically powered suspension system includes: an electromagnetic actuator; an information acquisition unit configured to acquire time-series information related to stroke position of the electromagnetic actuator, information on stroke velocity, and an amount of change in stroke of the electromagnetic actuator and information on a stroke direction based on the time-series information; a damping force calculation unit configured to calculate target damping force based on the information on the stroke velocity; and a drive control unit configured to control driving of the electromagnetic actuator using target driving force obtained based on the target damping force. The damping force calculation unit calculates equivalent friction compensation force based on the amount of change in the stroke and the information on the stroke direction, and corrects the target damping force based on the calculated equivalent friction compensation force. The equivalent friction compensation force has elastic force component and dynamic friction force component.
US11351827B2
An automobile suspension part includes an arm member and a reinforcement, wherein: the arm member includes a top wall part, a first ridge line part, a second ridge line part, a first side wall part, and a second side wall part; the top wall part includes a first attachment part at a first end part; the top wall part includes a second attachment part at a second end part; the reinforcement includes a bottom wall part, a third ridge line part, and a flange part; the third ridge line part is sandwiched between the bottom wall part and the flange part; the bottom wall part is joined to the first side wall part and the second side wall part; the third ridge line part is connected to the first side wall part and the second side wall part; the flange part is joined to the top wall part between the first attachment part and the second attachment part; and the flange part is connected to the first side wall part and the second side wall part.
US11351815B2
A bicycle cassette comprises a clampstyle connection for connecting the bicycle cassette to a bicycle hub driver body. The bicycle cassette is attached to a bicycle hub driver body by incorporating a clamp structure into one portion of the cassette, which then rigidly clamps onto the driver body of the bicycle hub. In addition, when combined with a bayonet style attachment structure between two parts of the cassette, it allows for the use of a smaller sprocket on one segment of the cassette. Specifically, it allows a small 9 or 10 tooth sprocket to overhang the cassette driver body on a bicycle hub, by attaching the small cog assembly to a larger cog assembly using a bayonet style attachment.
US11351800B2
There is provided an image recording apparatus including an image recording head; a scanner; a conveyer; and a controller. The controller is configured to execute first and second recording modes in which the controller causes the image recording head to accelerate to first and second velocities, to move at the first and second velocities, and then to decelerate from the first and second velocities, while causing the image recording head to record the image at least during moving at the first and second velocities, respectively. In a case that the controller has determined, based on printing data, that the image is to be recorded during a first velocity changing period, the controller executes the second recording mode. The first velocity changing period includes a first acceleration and deceleration periods in which the image recording head accelerates and decelerates, respectively.
US11351799B2
A recording device includes a recording unit configured to perform recording on a first surface of a medium, a holding unit configured to hold a roll body obtained by rolling the medium, a transport unit configured to transport the medium unwound from the roll body, and a knocking unit configured to knock on a second surface of the medium between the holding unit and the recording unit, the second surface being a surface opposite the first surface. The knocking unit knocks on the second surface by moving between a spaced position for being spaced apart from the second surface and a contact position for making contact with the second surface.
US11351787B2
A curved fluid ejection device may include a plurality of fluid ejection dies overmolded with at least one layer of epoxy mold compound (EMC). Each of the fluid ejection dies and the EMC include a coefficient of thermal expansion (CTE). The combination of the CTE of the fluid ejection dies and the CTE of the at least one layer of EMC defines a curve within the curved fluid ejection device.
US11351784B2
A liquid droplet ejection device includes at least one first liquid droplet ejection unit including a first liquid holding unit and a first tip, the first tip to eject the first liquid in the first liquid holding unit as a first liquid droplet onto an object; at least one second liquid droplet ejection unit including a second liquid holding unit and a second tip, the second tip to eject the second liquid in the second liquid holding unit as a second liquid droplet onto the object; an object holding unit to hold the object; and a driving unit to move the first tip and the second tip in a first direction. An inner diameter of the second tip is larger than an inner diameter of the first tip. The first tip and the second tip are arranged along the first direction. The second tip is arranged behind the first tip.
US11351783B2
A liquid ejection head includes a flow channel structure, a supply channel structure, a piezoelectric element, a sealing substrate, and a heater. The flow channel structure defines an ejection channel including an individual channel and a manifold. The individual channel has a nozzle and a pressure chamber in which pressure is applied to liquid for causing the liquid to be ejected from the nozzle. The supply channel structure defines a supply channel configured to allow the liquid to flow therethrough to the ejection channel. The piezoelectric element is positioned on an upper surface of the flow channel structure and facing the pressure chamber via a vibration plate. The sealing substrate is made of a material having a higher thermal conductivity than the supply channel structure. The sealing substrate surrounds the piezoelectric element on the flow channel structure to seal the piezoelectric element. The heater is disposed at the sealing substrate.
US11351776B2
In some examples, a circuit for use with a memory element and a nozzle for outputting fluid, includes a data line, a fire line, and a selector responsive to the data line to select the memory element or the nozzle. The selector is to select the memory element responsive to the data line having a first value, and to select the nozzle responsive to the data line having a second value different from the first value. The fire line is to control activation of the nozzle in response to the nozzle being selected by the selector, and to communicate data of the memory element in response to the memory element being selected by the selector.
US11351774B2
A printing apparatus, which uses a printhead including a circuit configured to inspect an ink discharge status of a selected nozzle using a temperature detection element, causes the printhead to inspect the ink discharge status by changing a threshold value for judging a detection result of the temperature detection element, in order to judge the ink discharge status in a state in which a heater in the selected nozzle is driven by each of a first pulse and a second pulse whose waveform is different from that of the first pulse, obtains first information about a change point where a judgment result obtained by the first pulse changes, and second information about a change point where a judgment result obtained by the second pulse changes, and sets the threshold value, based on the first and second information.
US11351772B2
A process for printing on to a 3-dimensional article is described. An image is printed on to a first side of a stretchable carrier membrane having a first side and a second side. The membrane is mounted in a plane within a frame between a heating chamber defined on one side of the membrane, and an article receiving chamber defined on the other side of the membrane. A 3-dimensional article to be printed is placed on to a generally flat platen positioned generally parallel to the said plane, optionally with a nest for the article thereon, within the article receiving chamber. A thermo- and vacuum-forming step is performed in which there is relative movement of the platen with respect to the membrane in a direction perpendicularly to the said plane to bring the article into register with the image printed on the membrane and to carry the article into intimate contact with the membrane through the said plane into the heating chamber. A source of vacuum is applied to the membrane from the said other side, and heat is applied to the membrane from the said one side at a first temperature sufficient to soften the membrane, whereby the membrane is thermo- and vacuum-wrapped at least partially about the article with the membrane in intimate contact with surface details of the article. A dye-diffusion step is performed in which infra-red radiation is applied to the article with the membrane wrapped therearound using at least two infra-red sources to heat the membrane and underlying surface of the article over substantially a half-spherical solid angle uniformly to a temperature in excess of the first temperature and for a time sufficient to cause the printed image to diffuse into the surface of the article but insufficient to damage the article.
US11351771B2
A method for separating printed products, that are printed together onto a sheet of printed products, is disclosed. The printed products are printed onto a sheet in a printing press and are separated in a cutting system by a cutting device. Each of these printed products has an identification feature that identifies its respective position on the sheet. The sheet becomes deformed as it passes through the printing press. The separated printed products, which are likewise deformed, as a result of the deformation of the sheet, are inspected, in a quality control device which is located downstream of the cutting system, for compliance with the tolerance, at least with regard to the respective length or width of the printed products. For each printed product that has been identified, in terms of its position, the quality control device detects information relating to an exceeding of the tolerance, at least for the length or width of the printed product, and transmits that information, assigning that information to the position identified on the sheet, to a control unit of the cutting system. Based on the information transmitted by the quality control device, for printed products that are arranged in the same position on the sheet, and which will subsequently be separated in the cutting system, the control unit of the cutting system adjusts the relevant sheet and the cutting device in their respective positions, relative to one another, in such a way that each of the printed products to be separated complies with the respective tolerance. Compliance with the tolerance is achieved in that the position of the sheet and of the cutting device to be adjusted relative to one another is calculated in the control unit using a mathematical optimization method. The sheet is placed on a cutting table in the cutting system. The control unit of the cutting system adjusts the position of the sheet relative to the cutting device, according to the calculated position.
US11351769B2
Disclosed is a process for the production of synchronous-pore layered materials. Also disclosed is a device for the conduct of the process. In further aspects, the invention relates to layered materials which can be produced by the process, and also to wood-composite boards equipped with the layered materials produced by the process of the invention.
US11351766B2
The invention comprises a method of making synthetic turf. The method comprises applying an ethylene-vinyl acetate copolymer adhesive to a first primary surface of a tufted primary backing to form a coating thereon and wherein the primary backing is tufted with a plurality of synthetic filaments to form a face pile extending outwardly from a second primary surface of the synthetic turf opposite the first primary surface and heating the ethylene-vinyl acetate copolymer adhesive to a temperature above its melting point so that the ethylene-vinyl acetate copolymer adhesive melts and at least partially flows into the primary backing. The method also comprises heating a linear low-density polyethylene film to a temperature below the softening point of the film and pressing the heated linear low-density polyethylene film into contact with the polymer coated first primary surface of the tufted primary backing. The method further comprises allowing the ethylene-vinyl acetate copolymer adhesive and the linear low-density polyethylene film to cool, whereby the linear low-density polyethylene film is adhered to the tufted primary backing.
US11351765B2
A system for laminating and/or de-bubbling mobile electronic device screens, comprises a machine unit comprising a metal vacuum pressure chamber with lid, safety sensors and o-ring; an internal or external vacuum pump; a piston chamber, piston and piston plate; a central air distribution block with solenoid valves and pressure sensor; a control PCB (printed circuit board) with processor and operating software system for controlling the machine unit; actuators; an on/off power switch; a power inlet; an operations button; an air inlet port and an external air compressor.
US11351757B2
A composite pane includes a first pane, a second pane, and a thermoplastic film arranged between the two panes, wherein at least one pane is in the form of a flat glass and at least one pane surface has a plurality of elongated elevations and elongated depressions that extend along a first pane direction and are alternatingly arranged in a second pane direction perpendicular to the first pane direction, the thermoplastic film is produced by extrusion and at least one film surface has a plurality of elongated elevations and elongated depressions that extend along a first film direction and are alternatingly arranged in a second film direction perpendicular to the first film direction, wherein the elongated elevations of the at least one pane are arranged at an angle different from 90° relative to the elongated elevations of the thermoplastic film.
US11351755B2
A metal-clad laminate includes an insulating layer including a cured product of a resin composition, and a metal foil disposed on at least one principal surface of the insulating layer. The resin composition includes a thermosetting curing agent and a polyphenylene ether copolymer. The polyphenylene ether copolymer has an intrinsic viscosity ranging from 0.03 dl/g to 0.14 dl/g, inclusive. The intrinsic viscosity is measured in methylene chloride at 25° C. And the polyphenylene ether copolymer has, at a molecular terminal, a group represented by one of formula (1) and formula (2) at an average number of more than or equal to 0.8 and less than 1.5 per one molecule. Further, the metal foil includes a barrier layer containing cobalt on a first surface of the metal foil. The first surface is in contact with the insulating layer, and has a ten-point average roughness (Rz) of less than or equal to 2.0 μm. In formula (1), R1 represents a hydrogen atom or an alkyl group having 1 to 10 carbon atoms, and R2 represents an alkylene group having 1 to 10 carbon atoms. In formula (2), R3 represents a hydrogen atom or an alkyl group having 1 to 10 carbon atoms.
US11351750B2
An improved expandable slit-sheet stock material is configured to aid in temporarily restricting opening of a plurality of slits of the slit-sheet stock material, such as during winding of the unexpanded stock material or during expansion of the stock material. Each slit of the plurality of slits includes one or more un-slit reinforcement portions, such as reinforcement ties, extending fully between opposite longitudinal sides of the slit, and disposed between opposed transverse endpoints of the slit. The reinforcement ties minimize or prevent tearing of the stock material during the winding or expansion. A dunnage conversion system for expanding the slit-sheet stock material includes an expander having a pair of opposed rollers. The rollers engage the stock material to effect breaking of the un-slit reinforcement portions and expansion of the slit-sheet stock material.
US11351740B2
A device for joining a lens with a housing of a lighting device of a motor vehicle, having a receiver for receiving and securing the housing and a pre-centering device for positioning the lens on the housing, wherein the pre-centering device includes a frame element and a plurality of positioning elements that are attached to the frame element for receiving the lens, wherein during a pre-centering process, the frame element of the pre-centering device is movable together with the joined lens relative to the receiver in such a way that the lens is aligned on the housing, which is received in the receiver.
US11351739B2
A force for adjusting a relative position of a regulating blade relative to a development rotary member supported by a development frame member is applied to the regulating blade so that a gap between the development rotary member and the regulating blade when attached to an attachment portion falls within a predetermined range in a rotational axis direction of the development rotary member in a state that the regulating blade is separated from the attachment portion with an adhesive applied. The regulating blade is attached, with the adhesive, to the attachment portion with the adhesive applied so that the gap between the development rotary member and the regulating blade with the force applied falls within the predetermined range.
US11351736B2
An NC device, which is a numerical control device, includes: a program analyzing unit that analyzes a machining program to obtain a movement path along which to move a supply position of a material on a workpiece; a storage temperature extracting unit that extracts, from data on surface temperature of the workpiece, storage temperature in an area including the movement path on the workpiece; a layering volume calculating unit that calculates a volume of a layer forming an object on the basis of a relation between the storage temperature and a volume of the material that solidifies at the storage temperature in a given time; and a layering shape changing unit that changes a shape of the layer on the basis of the volume of the layer.
US11351730B2
The invention relates to a stereolithography device having a replaceable bottle to receive printing material, which bottle may be stored in or on a bottle holder and from which printing material may be withdrawn into the stereolithography device by means of a device-sided holder. A filling level sensor is attached to the bottle holder by which a filling level of the printing material in the bottle can be detected. A mini memory device is associated to the bottle where the stereolithography device stores information regarding the printing material in the bottle, in particular the filling level thereof.
US11351729B2
An assembly-type axial drive module includes: a first motor having a gear protruding from a rear side thereof; a first board coupled to the rear side of the first motor; a second board coupled to a rear side of the first board; a third board coupled to a rear side of the second board; a fourth board coupled to a rear side of the third board; a fifth board coupled to a rear side of the fourth board; a sixth board coupled to a rear side of the fifth board; a seventh board coupled to a rear side of the sixth board to provide weight balancing; and a second motor coupled to a rear side of the seventh board and connected to a filament storage unit storing filaments to move the filaments.
US11351721B2
According to some aspects, an additive fabrication device is provided configured to form layers of material on a build platform, each layer of material being formed so as to contact a container in addition to the build platform and/or a previously formed layer of material. The additive fabrication device may comprise a container and a wiper, wherein the wiper comprises a wiper arm and a wiper blade coupled to said wiper arm using a pivoting coupling.
US11351714B2
A locking finger for a unit having a molding cavity for molding the container delimited at least by a first shell attached to a first mold carrier and by a second shell attached to a second mold carrier that is movable relative to the first mold carrier between an open position and a closed position, the first mold carrier comprising a control member for controlling the locking finger and the second mold carrier comprising a locking opening, the locking finger comprising an interface for mechanical coupling to the control member, and a locking portion designed to cooperate with the locking opening in the closed position. The molding unit is a subassembly of a plurality of mechanical parts assembled together rigidly, including a main body of the finger comprising the mechanical coupling interface, and said locking portion, which is a main sleeve made from anti-friction material assembled on the main body.
US11351708B2
An injection moulding tool for producing at least one injection-moulded part with an outer shape and an inner shape includes at least one cavity and, for every cavity, one hot-runner nozzle connected thereto, which has an annular nozzle mouth for injecting at least one melt into the cavity. The at least one cavity is formed by a cooled die, which forms the outer form for the outer shape of the injection-moulded part to be produced, and by a core, which forms the inner form for the inner shape of the injection-moulded part to be produced. The hot-runner nozzle has a nozzle core and a hollow needle, which can be moved along the nozzle core for opening and closing the annular nozzle mouth. The nozzle core protrudes beyond the annular nozzle mouth of the hot-runner nozzle and the nozzle core forms the core of the cavity of the injection mould.
US11351702B1
The present disclosure is directed at the deposition of multiple layers and/or multiple blends of fiber which optionally include other additives in a 3D mold. The resulting parts are particularly suitable for automotive acoustic parts that may be used, for example, in under-carpet applications, flooring, headliners, trunk liners, and inner and outer dash liners. The parts may also include acoustic exterior parts. The fibers may also be filled/packed differently within the mold at any specified location.
US11351699B2
Tool cores may have removable sections, which may be removable without damaging, cutting or severing attachment configurations for the removable sections. The removable sections may be handled simultaneously. Moving parts used to facilitate removal of the removable sections may be secured in a pre-loaded configuration.
US11351696B2
A system and method for forming a porous ceramic preform is provided. The method may include forming a stacked powder structure including a binder layer and a powder layer on the binder layer. The binder layer may be formed by depositing a binder with a spray nozzle on a substrate. The powder layer may be formed by depositing a powder on the binder layer. The porous ceramic preform may be formed by heating the stacked powder structure to pyrolyze the binder. The porous ceramic preform is configured to be infiltrated by a molten material. The substrate may comprise a ceramic fiber preform. After melt infiltration of the porous ceramic preform and the ceramic fiber preform, a densified ceramic feature having a predetermined geometry may be formed on a ceramic matrix composite (CMC) component.
US11351688B2
The present disclosure relates to a razor having a coupling structure of a razor blade cartridge and a handle, including a razor blade cartridge including at least one razor blade, a blade housing in which the at least one razor blade is accommodated, a cartridge frame coupled to the blade housing and configured to secure the at least one razor blade to the blade housing; and a handle coupled to a rear of the razor blade cartridge, wherein a first hook is formed at a rear of the blade housing; a second hook is formed at a rear of the cartridge frame; and the handle is configured to be engaged with the first hook and the second hook such that the handle is coupled to the rear of the razor blade cartridge.
US11351686B2
A haircut recording method, system and device, include a computing device having a feedback unit, and a hand-held device having a hair property measurement unit. The measurement unit is configured to detect a hair property value of interest, such as a hair length representing value, when the measurement unit is arranged adjacent to a haired portion. A position detection unit is configured to detect an actual position of the measurement unit. A record control unit is configured to operate the position detection unit for tracking the actual position of the measurement unit, operate the measurement unit for assigning detected hair property values to position values, deduce a condition parameter, such as a quality parameter, and provide user feedback based on the deduced condition parameter.
US11351681B2
The purpose of the invention is to provide a method for charging a robot and apparatus thereof. The invention according to the environment map and robot self-positioning information which is the position and orientation of the robot in the environment map, moves the robot to a position near a potential or registered charging pile; uses acquisition apparatuses such as laser to carry out line extraction of the structural data of the identification when the robot moves to short-range pile-searching connecting area, and combines with the preset structural data of the identification template, to carry out the recognition of the charging pile, after the collected structural data of the identification and the structural data of the identification template satisfy the preset matching degree, then the charging pile can be connected to the robot for charging.
US11351678B1
Systems, methods, and computer-readable media are disclosed for dynamically adjustable suction cups. In one embodiment, an example device may include a backplate, a gear coupled to the backplate and configured to move from a first position to a second position, a first suction cup segment having a first cavity, and a second suction cup segment disposed adjacent to the first suction cup segment, where a first portion of the second suction cup segment is disposed in the first cavity. Movement of the mechanical actuator from the first position to the second position may cause the first portion of the second suction cup segment to slide out of the first cavity, such that a surface area of a suction cup formed by the first suction cup segment and the second suction cup segment increases.
US11351673B2
A robotic sled-enhanced food preparation system includes a robotic kitchen assistant operable to determine and to perform food preparation steps, and an autonomous mobile sled operable to supply the robotic kitchen assistant with ingredients and supplies. The robotic kitchen assistant includes a scheduling engine to evaluate food inventory levels and automatically determine when to replenish the food inventories using the sled if the food inventory levels are insufficient to complete the food preparation steps. Related methods are also described.
US11351670B2
A domestic robotic system includes a robot and data storage operable to store data defining a boundary of a working area, the robot includes a payload actuable to perform work on a portion of the working area adjacent the robot, at least one processor, a first positioning system, one or more sensors operable to sense directly the boundary of the working area and a current distance of the robot thereto, a second positioning system, which uses data from the sensors. The processor is programmed to operate in (i) an area coverage mode, wherein the processor, using the first positioning system and the stored data defining the boundary of the working area, navigates the robot around the working area, with the payload active, and (ii) a boundary proximity mode, wherein the processor, using the second positioning system, navigates the robot around the working area, in proximity to the boundary.
US11351666B2
A drill bit in conjunction with a hammer-drill to penetrate composite metal and non-metal structure or structures including, for example, thick metal or rebar encountered during concrete, rock or masonry boring operations without requiring a change in drill equipment.
US11351664B2
An electrically isolated coupler includes a drive body, a driven body, and a torque transfer assembly. The drive body is made of first metallic material and has a drive end configured to interface with a fastening component. The drive body includes a first interface portion and the driven body includes a second interface portion. The driven body is made of a second metallic material and has a driven end configured to interface with a driving tool. The torque transfer assembly is disposed between the drive body and the driven body to electrically isolate the drive body and the driven body from each other and transfer torque between the drive body and the driven body. The torque transfer assembly includes non-conductive material configured to maintain separation between the drive body and the driven body of at least about 0.400″.
US11351660B2
A reversible ratchet wrench includes a moveable pawl connected to a handle via a linkage such that the pawl cannot become disengaged from the hand during operation of the wrench. The handle is pivotally attached to housing forming a portion of a head of the wrench, where pivoting of the handle between a first position and a second position switches a position of a pawl between a first position and a second position to thereby change an operating direction of the wrench. A distance of movement of a proximal end of the handle, opposite a head of the wrench, during switching is confined to a limited range by elongating the wrench head and extending a distance between a connection point of the handle to the pawl and the pivotal connection of the handle to the housing.
US11351657B1
A panel support assembly is presented herein. The panel support assembly includes a support base, a fixed support structure and a swing arm assembly. The fixed support structure extends from the support base and defines at least one vertical panel engaging surface. The swing arm assembly is pivotally attached to the base and is disposable between a normally biased, at least partially raised position and a lowered, clamped position. The swing arm assembly includes a base, a swing arm panel and a pivoting pressure plate. A biasing device is attached to the base of the swing arm assembly and is configured to normally bias the swing arm assembly into the at least partially raised position until an opposing weight is applied to the base of the swing arm assembly that will oppose the biasing force and automatically position the swing arm assembly into the lowered clamped position.
US11351652B2
Silicon (Si) based high temperature coatings and base materials and methods of making those materials. More specifically, methods and materials having silicon, oxygen and carbon containing polymer derived ceramic liquids that form filled and unfiled coatings, including high temperature crack resistant coatings.
US11351648B2
Present disclosure provides chemical mechanical polishing (CMP) apparatus, including a counterface configured to support a semiconductor wafer at a first surface, a first electromagnet array under the first surface, a polishing head over the counterface and configured to hold the semiconductor wafer at a second surface, and a controller connects to the first electromagnet array. The first electromagnet array comprises a plurality of electromagnets, a polarity of each of the plurality of electromagnets is capable of being individually controlled by the controller. Present disclosure also provides a CMP slurry and a method for using a chemical mechanical polishing apparatus.
US11351635B2
A semiconductor fabrication apparatus includes a source chamber being operable to generate charged particles; and a processing chamber integrated with the source chamber and configured to receive the charged particles from the source chamber. The processing chamber includes a wafer stage being operable to secure and move a wafer, and a laser-charged particles interaction module that further includes a laser source to generate a first laser beam; a beam splitter configured to split the first laser beam into a second laser beam and a third laser beam; and a mirror configured to reflect the third laser beam such that the third laser beam is redirected to intersect with the second laser beam to form a laser interference pattern at a path of the charged particles, and wherein the laser interference pattern modulates the charged particles by in a micron-zone mode for processing the wafer using the modulated charged particles.
US11351634B2
An example system may include a material source and a substrate having a molten pool on a surface of the substrate, wherein the molten pool faces a downward direction defined with respect to gravity. The system may include a computing device. An example technique may include, by the computing device, controlling the material source to direct a stream of solid material to the molten pool in an upward direction defined with respect to gravity. The material combines with the molten pool to form a deposited volume of a plurality of deposited volumes. The plurality of deposited volumes defines a component. An example computer readable storage medium may include instructions that, when executed, cause at least one processor to control, based on a digital representation of the component, an energy source to direct an energy beam at the substrate to form the molten pool, and control the material source.
US11351630B2
A processing state detecting device for detecting a processing state of a workpiece processed by laser processing includes: a sound collecting unit that measures sound while the workpiece is being processed by laser processing; an installation position evaluating unit that determines whether an installation position of the sound collecting unit needs to be changed, on the basis of the sound measured by the sound collecting unit; and an evaluation result informing unit that provides information on a result of evaluation of the installation position evaluating unit.
US11351626B2
A spot-welding system including a spot-welding gun including a movable part including a movable electrode, and a drive part that drives the movable part, a controller that controls the drive part, an applied pressure sensor that measures an applied pressure from the movable electrode of the spot-welding gun, and an own-weight calculator that calculates an own weight of the movable part based on the applied pressure detected by the applied pressure sensor in two different postures of the spot-welding gun that places the movable electrode in different movement directions. The controller superimposes a dither signal onto a control signal so as to control the drive part in measuring the applied pressure for use in calculating the own weight of the movable part by the own-weight calculator, and after the own weight is calculated, the controller corrects the control signal based on the calculated own weight.
US11351622B2
A laser soldering system is disclosed. The laser soldering system has a moving system, a gripper mounted on the moving system, a presser mounted on the moving system and having a transparent member, and a laser. The gripper grips an object and places the object at a target location on a product to be soldered. The transparent member presses the object against the product. The laser emits a laser beam through the transparent member to solder the object to the target location while the object is pressed against the product.
US11351617B2
In an aspect, a rotating tool includes a main body having a rod shape and extending along a rotation axis. The main body includes a first end, a second end, a twisted cutting edge located at a side of the first end, a twisted flute, a reverse twisted cutting edge located closer to the second end than the twisted cutting edge, and a reverse twisted flute. The reverse twisted flute is connected to the twisted flute. The twisted cutting edge includes a first part having a length from the rotation axis decreasing as approaching toward the second end.
US11351611B2
A structural joint between two components of metal material is obtained by carrying out an electrical resistance welding spot between said components and subsequently performing a step of applying a cladding of metal material by an additive manufacturing technology. In one example, after a first step of applying a coarse base cladding, a second step of applying a fine cladding is carried out, again by additive manufacturing technology. The fine cladding can include a distribution of stiffening micro-ribs above the base cladding. The same method can also be applied to a single sheet metal component, rather than to a welded joint.
US11351597B2
An intelligent riveting system comprising a hydraulic riveting tool (1), a riveting position identification system, a riveting displacement detection system, a riveting pressure detection system and a central processing system, wherein the central processing system acquires image information and carries out position identification, encoding and storage to form riveting position data in one-to-one correspondence, acquires real-time displacement data and riveting oil pressure data of each riveting position to form real-time data corresponding to riveting displacement values and riveting pressure values, and compares same with a standard to carry out quality determination. By means of the intelligent riveting system, a riveting position and an installation parameter are automatically identified and acquired, and the riveting quality is automatically determined; and by means of storing data during riveting and installation, the traceability of rivet installation quality can be achieved.
US11351596B2
A material-forming device for a wire mesh includes a plurality of contact rods that are supported by the frame and configured to threadedly receive a sheet of wire mesh that moves through the plurality of contact rods in a downstream direction. An inner contact rod and an outer contact rod are each configured to engage a first side of the sheet of wire mesh, and a middle contact rod is positioned between the inner contact rod and the outer rod and configured to engage a second side of the sheet of wire mesh that opposes the first side. The shape of the outer contact rod and/or the inner contact rod is configured to bend the sheet of wire mesh around the middle contact rod as the sheet of wire mesh moves in the downstream direction.
US11351591B2
A hold device is attached to press tooling. The hold device includes a distance member attached to a holder, and a moving device attached to a first die unit. The holder is provided in a movable manner with respect to a punch in a press direction, and a pad is provided in a movable manner with respect to a die in the press direction. The distance member is pivotable between a home position in which the distance member does not come into contact with the second die and a preventive position in which the distance between the pad and the holder in the press direction is prevented from being equal to or less than a predetermined distance. As the holder moves relative to the punch in the first direction, the moving device causes the distance member to pivot from the home position toward the preventive position.
US11351586B2
An apparatus and a method for producing an elongated profiled part, in which a profiled strip is produced from a flat strip by rolling and the profiled strip is embossed in sections, by means of which at least one longitudinal section of the profiled strip is offset relative to at least one other longitudinal section in a direction perpendicular to the longitudinal direction of the profiled strip, and with which method the strip is trimmed in such a way that, after the embossing, the longitudinal sections that are offset relative to each other have different cross-sections. In order to increase the reproducibility of the method, before the profiling, the flat strip is trimmed in such a way that by means of the embossing of the trimmed and profiled strip, the longitudinal sections that are offset relative to each other have different cross-sections.
US11351584B2
A calibration determination device includes: a free roll that conveys the bonding member; a load detection device that detects a load applied to a bearing of the free roll; a tension adjustment device that winds the bonding member to increase a tension applied to the bonding member and unwinds the bonding member to reduce the tension applied to the bonding member so as to adjust the tension applied to the bonding member; and a calibration determination unit that determines whether calibration of the load detection device is necessary. The tension adjustment device unwinds the bonding member to cause the bonding member not to be subjected to the tension, and the calibration determination unit determines whether the calibration of the load detection device is necessary based on the load detected by the load detection device with the bonding member not being subjected to the tension.
US11351583B2
A method of treating a heavy metal contaminated soil including contacting the contaminated soil with a bioremediation mixture for a predetermined time such that the contaminated soil is anaerobically digested, wherein the contaminated soil contains one or more heavy metals, and wherein the anaerobically digested soil contains a lesser amount of the one or more heavy metals than the contaminated soil.
US11351575B2
A drop perception system is disclosed that includes an open housing structure having an internal volume, an open top and an open bottom, and a plurality of perception units positioned to capture perception data within the internal volume at a plurality of locations between the open top and the open bottom of the open housing.
US11351573B2
A disc screen for separating solid residues which comprises multiple parallel rotation shafts, each of which carrying, fixed thereto, a plurality of discs. The lateral faces of the aforesaid discs are provided with thrust wings having curved section, which are adapted to intercept components of the material to be screened, in particular light or filamentous materials, in order to expel them outside the interspaces between the discs, so as to prevent possible tangling and obstruction of such materials at the rotation shafts.
US11351570B2
The present disclosure describes a system including: at least one ceramic foam comprising a porous top surface, porous channels, and a porous bottom surface, wherein the at least one ceramic foam is over a surface of a solar panel such that when dust particles are poured onto the porous top surface of the at least one ceramic foam, the dust particles permeate through the porous channels of the at least one ceramic foam and then exit from the porous bottom surface of the at least one ceramic foam to form a layer of dust, with a pre-determined thickness, on the surface of the solar panel.
US11351554B2
A carrier plate, which is used within an electrophoresis process, and to a holding device tailored to the carrier plate, the carrier plate having a region with a magnetic property and a positioning device. The magnetic property is designed to fix the carrier plate in the laboratory device. The positioning device is designed to guarantee a position of the carrier plate in the laboratory device.
US11351551B2
Disclosed are multi-well plate inserts that can be used to separate solid debris, including paper punch containing a blood sample, from a liquid containing target biological molecules, such as nucleic acid molecules and proteins. Also provided are methods of using the insert, for example as part of a method that analyzes target biological molecules.
US11351539B2
A multi-level microfluidic device is provided. The device includes a silicon wafer substrate and a stack of layers arranged on the silicon wafer substrate. The stack comprises a plurality of fluidic silicon layers, wherein each fluidic silicon layer includes a microfluidic structure at least one intermediate layer. The at least one intermediate layer is arranged between two fluidic silicon layers, and a fluid inlet and a fluid outlet in fluid connection with at least one of the fluidic silicon layers. Each layer in the stack is formed by deposition or growth. Methods for manufacturing microfluidic devices is also provided.
US11351526B2
Provided are a novel form of AFX zeolite, a novel synthesis technique for producing pure phase small pore zeolites, a novel synthesis method for producing a zeolite with an increased Al pair content, a catalyst comprising the AFX zeolite in combination with a metal, and methods of using the same.
US11351524B2
It is intended to provide a novel zeolite with a rare earth element-substituted framework which has a higher amount of NOx adsorbed and a method for producing the same, and a NOx adsorption member and a catalyst for automobile exhaust gas, etc. comprising the same. The present invention provides a zeolite with a rare earth element-substituted framework, comprising at least a zeolite and at least one rare earth element selected from the group consisting of Ce, La, Nd and Pr, wherein a content ratio of the rare earth element is 1 to 15% by mass in total based on the total amount, and one or some of Al and/or Si atoms constituting the framework of the zeolite are replaced with the rare earth element.
US11351521B2
A supported core-shell bimetallic catalyst with high selectivity, and preparation method and an application thereof are provided. SBA-15 is used as support, platinum (Pt) is used as active component, 3d transition metal is used as cocatalysts. In the core-shell bimetallic catalyst formed by the 3d transition metal and Pt, in one aspect, by the addition of the 3d metal in the core, the d-band center of surface Pt atoms is down shifted, and the absorption of propylene is weakened, thereby improving the selectivity for propylene. In another aspect, the use of Pt is reduced by the addition of the 3d transition metal, improving the utilization of Pt. The catalyst is applicable in a hydrogen atmosphere, has a good effect on the preparation of propylene by propane dehydrogenation and causes high dehydrogenation activity under high temperature conditions. The total selectivity for propylene may reach 85%, which achieves high propylene selectivity.
US11351515B2
A structural improvement for microwave-assisted high temperature high-pressure chemistry vessel systems is disclosed that among other advantages offers dynamic venting and resealing while a reaction proceeds and eliminates the risk of cross contamination associated with systems that use a common pressurized chamber. The improvement includes a relatively thin-walled disposable liner cylinder that includes one closed end and one open end defining a mouth, and a liner cap positioned in the mouth of the rigid liner cylinder for closing the rigid liner cylinder. The liner cap includes a depending column that engages the inside diameter of the rigid liner cylinder, and a disk at one end of the depending column having a diameter sufficient to rest upon the rigid liner cylinder without falling into the rigid cylinder liner so that the cylindrical liner cap can rest in the rigid liner cylinder at the mouth of the rigid liner cylinder. The depending column, includes a passage to provide a gas venting space, and a dynamic venting action, between the liner cap and the rigid liner cylinder.
US11351504B2
A hollow fiber membrane module includes: a tubular case; a hollow fiber membrane bundle; and a pair of sealing and fixing portions, in which an outside-membrane channel that passes by an outer wall of each of the hollow fiber membranes and an inside-membrane channel that passes through the hollow inside of each of the hollow fiber membranes are formed, moist air flows through the outside-membrane channel, and dry air flows through the inside-membrane channel, whereby moisture in the moist air is supplied to the dry air by a membrane separation effect of the hollow fiber membranes, wherein a plurality of spaces are disposed between the case inner wall and the hollow fiber membrane bundle, and a restriction portion that restricts the hollow fiber membrane from entering into the spaces is partially disposed between the hollow fiber membrane bundle and each of the spaces.
US11351497B2
The invention relates to a method for separating chlorine from a gaseous anode outlet stream mass flow of an electrochemical cell reactor. In a first aspect, the method makes use of an absorption step, wherein an anode outlet stream mass flow of the electrochemical cell reactor is exposed to an organic solvent being essentially immiscible with water for achieving an exergy-efficient separation of chlorine and hydrogen chloride. In a further aspect, the method makes use of absorption step, wherein the anode outlet stream mass flow is exposed to an ionic liquid, wherein the hydrogen chloride is dissolved in said ionic liquid, thereby forming a gas flow containing essentially chlorine and a solution mass flow comprising the ionic liquid and the hydrogen chloride. The hydrogen chloride is desorbed from the solution mass flow in a desorption step. In another aspect, the method makes use of a distillation step, wherein the anode outlet stream mass flow is separated at a static pressure of at least 2 bar for an exergy-efficient separation.
US11351490B1
A method for filtering a precipitatable constituent from an extraction solution through a filter apparatus includes pre-cooling at least a portion of the filter apparatus to a reduced temperature that is effective to precipitate the constituent from the extraction solution. At least the cooled portion of the filter apparatus may be thermally conductive to act as a heat sink for the extraction solution being passed through the filter apparatus. The reduced temperature facilitates removal of the precipitatable constituent from the extraction solution.
US11351483B2
A dewatering unit in the form of a railcar having bogies thereon to move the unit on rail tracks. The dewatering unit has first and second ends, first and second sides, and a bottom that bound and define an interior chamber. A conveyor is provided in the interior chamber and screens are located in the bottom and first and second sides. A grizzly is located below an opening in the unit's top and above the conveyor. Stabilizing assemblies are deployed to contact the ground and lift some weight off of the bogies prior to loading. A solid material/liquid mixture is dropped through the opening and onto the grizzly which partially fractures the solid material. Further fracturing is undertaken by conveyor drag bars and crushers located adjacent the conveyor. Liquid drains from the unit through the screens. The dewatered solid material is lifted out of the unit by the conveyor.
US11351480B2
A computer-implemented method includes receiving, by a programmable logic controller coupled to a control unit associated with a vessel containing oil and water within a Gas-Oil-Separation Plant (GOSP), a first signal representing a first capacitance measurement detected by a first capacitance probe attached to the vessel at a first elevation. Determining whether an alarm condition is met by detecting whether the first capacitance measurement is higher than a first predetermined maximum limit, or a rate of change (ROC) of the first capacitance measurement is higher than a first predetermined ROC limit, or both. If the alarm condition is met, sending an alarm signal indicating that an upcoming process upset has been detected within the vessel. Subsequent alarms at higher elevations, if available, can alarm operators if the emulsion layer thickness continues to increase and further mitigation measures are required (such as higher demulsifier dosage, skimming of emulsion layer, etc.).
US11351467B2
An image processing unit 118 generates a distribution image including a game image. A distribution processing unit 126 distributes the distribution image to one or more of information processing terminals through a shared server. A participation processing unit 128 accepts play requests of viewing users operating the information processing terminals and approves a game play of one of the viewing users who has made a request for a play. An application execution unit 110 processes a game using operation information transmitted from the information processing terminal operated by the viewing user the game play of which has been approved.
US11351461B2
A system, a machine-readable storage medium storing instructions, and a computer-implemented method are described herein for an Alliance Engine. The Alliance Engine receives a selection, by a first player, of a first tile to be controlled by a first enforcer asset on behalf of the first player. The first tile provides access to a first type of in-game resource to the first player. The Alliance Engine detects the first tile is adjacent to a second tile. The second tile is controlled by a second enforcer asset on behalf of a second player. The first player and the second player belong to a player alliance. The second tile providing access to a second type of in-game resource to the second player. Based on the detected adjacency, the Alliance Engine transfers a portion of the first type of in-game resource of the first tile to the second player. The Alliance Engine transfers a portion of the second type of in-game resource of the second tile to the first player.
US11351460B2
A method for optimizing a computer-implemented game for a target metric is disclosed. Based on a detecting that an optimization point has been reached during a runtime of the computer game, user data, game state data, and personalized gaming experience (PGE) question data is communicated to a PGE server. The PGE question data is linked to the optimization point. An answer corresponding to the PGE question data is received from the PGE server. The answer is selected from a plurality of answers linked to the optimization point based on an application of a machine-learned model to the user data, game state data, and PGE question data. The received answer is implemented within the computer-implemented game.
US11351455B2
Systems, methods, and apparatuses are provided for interconnecting plugins of a content overlay engine that is executed with a video game. In an example system, a data manager that includes a plugin manager and an event reporting orchestrator is executed concurrently with the video game. The plugin manager identifies a set of plugins that includes at least a consumer plugin and a producer plugin coupled to the data manager. The plugin manager also identifies an event type that is to be reported to the consumer plugin. The event reporting orchestrator receives a notification of a first event from the producer plugin during execution of the video game, and determines if the first event is of the event type to be reported to the consumer plugin. If the first event is of the event type, information associated with the first event is reported to the consumer plugin.
US11351449B2
A device or system is provided that provides olfactory stimuli, and includes a piezoelectric vibration device that is used to produce scents corresponding to actions performed in a VR or AR environment, or other application. In some implementations, a user interacts with one or more game elements within a game program being executed by a game engine, and responsive to the interaction, the game engine may communicate a series of commands that cause a piezoelectric device of the device to generate scents to be experienced by the user.
US11351443B2
An electromagnetic game board includes a configurable grid of electromagnets under a game board to move game pieces on the board. Alternative to electromagnets is acoustic levitation through soundwave. In an oscillating electric field (four sides), a magnet can create excite ultrasound that quickly contract and rebound its original shape to push out pulses of air.
US11351434B2
Power measurement device for a bicycle trainer, which device is built as a unitary relocatable device comprising an acceleration or velocity sensor, a microcontroller and a memory, wherein the device is equipped with or connectable to a power source, preferably a battery, and wherein the device is equipped with a communication facility to enable the device to wirelessly or through wires communicate with an external application device.
US11351432B2
A soccer training device and system includes a generally horizontal and planar platform and at least one sloped soccer ball collection trough provided generally around a perimeter of the platform. A segmented cage is provided generally at and around outer bounds of, and vertically above, the platform. At least one sensored gate includes at least one soccer ball impact curtain provided above the at least one soccer ball collection trough to direct soccer balls into the trough, and at least one arrangement of sensors to sense presence of the soccer balls that are impacting the at least one curtain. A ball thrower sequentially receives the soccer balls from the silo, to sequentially deliver the soccer balls to a player on the platform. A control panel and a control box control operation of the soccer training device and system.
US11351421B2
A computer implemented system provides a cruise control function, during a fitness equipment-based workout, to report a power output amount based on a cruise control set-point. The system includes a piece of fitness equipment, a control device, and a computing device. The fitness equipment produces an output corresponding to actual power produced on the fitness equipment. The control device transmits an indication of power being produced to the computing device as an input to a fitness training game. In a first operational state, the indication represents the actual amount of power being produced via operation of the fitness equipment by the user, but in a second operational state, the numerical indication is a virtual power amount corresponding to a cruise control set-point amount established via the control device.
US11351419B2
An apparatus for a smart gym is described herein. The smart gym includes a platform and at least one camera. The platform comprises at least a weight sensor. The at least one camera is configured to capture movements on the platform. In some cases, an exercise is identified by comparing the joint movement to a known joint movement associated with the exercise.
US11351417B2
A method of exercising includes positioning a foot of a user onto a pedal of an exercise device. The pedal is pivotably connected to a pair of supports forming a triangular base and has a neutral position relative to a pivot axis of the device. The method includes applying a first force to the pedal to rotate the pedal about the pivot axis in a first direction, toward a first support. The method includes resisting movement of the pedal toward the first support with a resistance mechanism of the device. The method includes applying a second force to the pedal to rotate the pedal about the pivot axis in a second direction, opposite the first direction, toward a second support and away from the first support. The method includes resisting movement of the pedal toward the second support with the resistance mechanism of the device.
US11351415B1
A portable multi-exercise device includes a pair of parallel tracks each being elongate and linear. The exercise device includes a pair of band attachment platforms positioned across the parallel tracks respectively proximate to ends of the parallel tracks, the band attachment platforms having at least two laterally spaced apart resistance band attachment structures and themselves being laterally positioned along the parallel tracks. Each band attachment platform may include a set of three spaced apart planks defining a slot therebetween in which band fasteners are positioned. The exercise device includes a pair of step platforms atop which a user stands when grasping resistance bands during exercise, the step platforms being laterally adjustable along the parallel tracks. The exercise device includes a rowing bar coupled to the pair of parallel tracks intermediate the band attachment platforms and having fasteners for attachment to the resistance bands.
US11351413B2
A bicycle training system and methods of using the same. The system includes a movement platform that rests on a support surface and supports a bicycle in an upright manner with respect to the support surface. The movement platform includes a support frame having a base and at least one upstanding arm that supportably engages a portion of a frame of the bicycle, a resistance assembly operatively coupled to a portion of a drivetrain of the bicycle that applies varying levels of resistance to the portion of the drivetrain, and a plurality of bushings isolating the base from the support surface. The plurality of bushings are spherical thereby permitting the movement platform to move with respect to the support surface in response to forces applied to the bicycle frame during use of the bicycle training system.
US11351405B2
A safety harness bridge rope engagement system includes a harness and a pair of bridge connectors attached to the harness. The bridge connectors are configured to engage a bridge rope. Each of the bridge connectors has a plurality of channels therein. One of the channels is selected to receive a bridge rope to retain the bridge rope at the selected location to adjust the point of pressure between the harness and user of the harness.
US11351404B2
An apparatus includes a door frame, a carriage movable along a path relative to the door frame, a window, a bolt fixing the window to the carriage, a housing fixed to the window by the bolt, a striker mounted in the housing, and a pyrotechnic charge positioned to drive the striker into the window.
US11351402B2
A method for producing a film of the present invention includes the step of electrostatically spraying a liquid composition directly on the surface of skin using an electrostatic spray device to form a film on the skin. The electrostatic spray device includes a container capable of storing the liquid composition, a nozzle configured to eject the liquid composition, a power supply configured to apply a voltage to the nozzle, and a voltage stabilizer configured to stabilize the voltage applied by the power supply to the nozzle. The liquid composition contains component (a): one or more volatile substances selected from alcohols and ketones, and component (b): a polymer having film formability.
US11351394B2
The present invention provides a method for manufacturing a neural probe incorporated with an optical waveguide. The method for manufacturing a neural probe incorporated with an optical waveguide comprises the following steps. A mold-filling step, for providing a base with at least one groove formed therein. A disposing step, for disposing and overlaying a substrate having a plurality of electrode parts on the groove of the base. A combining step, for solidifying the photosensitive adhesive by a solidification process, the solidified photosensitive adhesive forming an optical waveguide and being combined with the substrate. A mold-releasing step, for removing the base from the optical waveguide and the substrate, the substrate and the optical waveguide forming a product.
US11351387B2
A method for manufacturing a singulated feedthrough insulator for a hermetic seal of an active implantable medical device (AIMD) is described. The method begins with forming a green-state ceramic bar with a via hole filled with a conductive paste. The green-state ceramic bar is dried to convert the paste to an electrically conductive material filling via hole and then subjected to a pressing step. Following pressing, a green-state insulator is singulated from the green-state ceramic bar. The singulated green-state insulator in next sintered to form an insulator that is sized and shaped for hermetically sealing to close a ferrule opening. The thusly produced feedthrough is suitable installation in an opening in the housing of an active implantable medical device.
US11351383B2
A method and implantable medical device system for delivering a left ventricular (LV) cardiac pacing therapy via a single-pass coronary sinus lead and sensing far-field cardiac signals via one or more far-field sensing vectors formed between the plurality of electrodes. Beat morphologies corresponding to the far-field cardiac signals are determined, and a beat morphology match between each of the far-field beat morphologies and an intrinsic beat morphology template is determined so that one of loss of LV capture, pseudo fusion and loss of synchrony is determined in response to the determined beat morphology match. One of a loss of capture adjustment, a pseudo fusion adjustment, and a resynchronization adjustment is performed in response to the determined one of loss of LV capture, pseudo fusion and loss of synchrony in response to the determined beat morphology match to generate an adjusted LV cardiac pacing therapy.
US11351379B2
A method for controlling synchrony in a plurality of brain regions of a subject includes receiving signals from a source region of the subject's brain, determining at least one phase of the signals from the source region in a predetermined frequency band and delivering at least one stimulation pulse to at least one target region of the subjects brain based on the at least one phase of the signals from the source region to synchronize oscillations of the source region and the at least one target region.
US11351370B2
Systems and methods for treating cognitive dysfunction and/or depression using transcutaneous auricular neurostimulation therapy may include positioning a wearable neurostimulation device about the ear of the patient, connecting the wearable neurostimulation device, to a pulse generator, and delivering a first series of stimulation pulses to at least one first electrode, the first series being configured to increase monoamine neurotransmitter availability, and delivering a second series of stimulation pulses to at least one second electrode, the second series being configured to upregulate opioid receptor agonists.
US11351368B2
Methods and apparatuses (systems, devices, etc.) for treating biological tissue to evoke one or more desirable biological and/or physiological effects using pulsed electric fields in the sub-microsecond range at very low electric field strength (e.g., less than 1 kV/cm) but at high (e.g., megahertz) frequencies.
US11351362B2
A kit for transcranial brain stimulation is disclosed. The kit comprises a headset for transcranial brain stimulation, and a non-transitory computer-readable recording medium having recorded thereon a program which is executable on an electronic device having processing capabilities. The program comprises program code portions which when executed on the electronic device is configured to: store, in a computer memory, a schedule for performing the transcranial brain stimulation; and generate a control signal for the headset such that transcranial brain stimulation is performed according to the schedule for performing the transcranial brain stimulation. The headset comprises: a wireless transceiver configured to wirelessly communicate with the electronic device; a circuit comprising a first electrode, a second electrode and a power source configured to provide power to the circuit; and a controller being configured to control powering of the circuit according to the control signal.
US11351359B2
An improved system for supporting (e.g., localization and/or positioning of) intravascular devices discussed herein provides for example a multi-element arrangement. A set of struts optionally projects from the intravascular device and contacts the vessel walls. The localization and positioning of the pump may be provided by the struts and/or by use of a tether opposing a propulsive force to ensure localization.
US11351354B2
An extension set may include a clamp, which may include a housing and an actuator. The actuator may be movable between a raised position and a depressed position with respect to the housing. The actuator may include a bump profile. The extension set may include an extension tube, which may be disposed within the housing. The extension tube may include a loop. In response to movement of the actuator between the raised position and the depressed position with respect to the housing, the bump profile may progressively clamp the extension tube along the loop. The loop may facilitate an increased fluid volume flowing distally towards a catheter in response to actuating the clamp.
US11351353B2
Systems, methods, and articles for providing an antimicrobial composition to the proximal elements of a trans-dermal catheter and into the lumen of the transdermal catheter are disclosed. In an embodiment, an antimicrobial composition on surface a cap element transfers antimicrobial to the proximal end of the transdermal catheter. The system comprises an elongate member configured for insertion into a lumen of a catheter, the elongate member containing an antimicrobial.
US11351347B2
This invention relates to a device and method for the vacuum-assisted delivery of drugs through an intact surface membrane of an organ.
US11351345B2
Systems and methods for selective auto-retroperfusion along with regional mild hypothermia. In at least one embodiment of a system for providing a retroperfusion therapy to a venous vessel of the present disclosure, the system comprises a catheter for controlling blood perfusion pressure, the catheter comprising a body having a proximal open end, a distal end, a lumen extending between the proximal open end and the distal end, and a plurality of orifices disposed thereon, each of the orifices in fluid communication with the lumen, and at least one expandable balloon, each of the at least one expandable balloons coupled with the body, having an interior that is in fluid communication with the lumen, and adapted to move between an expanded configuration and a deflated configuration, and a flow unit for regulating the flow and pressure of a bodily fluid, and a regional hypothermia system operably coupled to the catheter, the regional hypothermia system operable to reduce and/or regulate a temperature of the bodily fluid flowing therethrough.
US11351344B1
A rigid hollow tubular adapter releasably attached at a longitudinal nozzle end to a flexible tube during equine nasogastric intubation comprising an annular sleeve having a stationary tubular member and a slidable tubular member. The slidable tubular member is delimited at its ends by the stationary tubular member and a detent member disposed between an equine reflux drainage hole and a longitudinal mouthpiece end. Operator's puffs of airflow through a mouthpiece urges the slidable member to slide toward the detent member closing the equine drainage hole to enable passage of medication into the equine stomach. Equine reflux urges the slidable tubular member to slide toward the stationary tubular member opening the reflux drainage hole to divert equine backflow downwardly through the equine backflow drainage hole preventing passage of equine reflux into the operator's mouth.
US11351341B2
Disclosed is a bladder drainage apparatus comprising a tube including a hollow interior extending through the tube, a flexible anchor, which behaves spring-like, connected to or at one end of the tube, and a magnetic member connected to or at the other end of the tube. The tube is moveable when the magnetic member is engaged by an external magnetic force, creating magnetic traction, and moving the tube, e.g., outward (from its original position, where the sphincter is typically closed), such that it holds open a sphincter, allowing urine to drain from the bladder, to the urethra, to outside of the body. When the external magnetic force is released, the magnetic engagement is terminated, and the force of the flexible anchor pulls the tube back to its original position, whereby the sphincter is again closed, and accordingly urine flow is stopped or otherwise limited.
US11351340B2
An apparatus includes a catheter, a housing configured to house at least a portion of the catheter, and an actuator movably coupled to the housing. The housing has a first port configured to receive a proximal end portion of the catheter and a second port configured to couple the housing to an indwelling vascular access device. A portion of the actuator is disposed within the housing and is configured to be movably coupled to a portion of the catheter. The actuator is configured to be moved a first distance to move a distal end portion of the catheter a second distance greater than the first distance from a first position to a second position. The distal end portion of the catheter is disposed within the housing when in the first position and is distal to the indwelling vascular access device when in the second position.
US11351339B2
An orientable catheter (10, 110, 210) comprising a first tubular body (16, 116, 216) having a distal portion with shape memory (26, 126, 226) which is curved at rest, and a second tubular body (38, 138, 238) having a distal stiffening portion (54, 154, 254) forming a stiffening element capable of sliding relative to the first tubular body (16, 116, 216) between a stiffening position in which the stiffening element (54, 154, 254) imposes a straightened configuration on the distal portion with shape memory (26, 126, 226), and a retracted position in which the stiffening element (54, 154, 254) does not interfere with the resting curved configuration of the distal end with shape memory (26, 126, 226).
US11351334B2
A breathable gas inlet control device permits flow regulation at the inlet of a flow generator for a respiratory treatment apparatus such as a ventilator or continuous positive airway pressure device. The device may implement a variable inlet aperture size based on flow conditions. In one embodiment, an inlet flow seal opens or closes the inlet to a blower in accordance with changes in pressure within a seal activation chamber near the seal. The seal may be formed by a flexible membrane. A controller selectively changes the pressure of the seal activation chamber by controlling a set of one or more flow control valves to selectively stop forward flow, prevent back flow or lock open the seal to permit either back flow or forward flow. The controller may set the flow control valves as a function of detected respiratory conditions based on data from pressure and/or flow sensors.
US11351324B2
A vent assembly for a respiratory pressure therapy (RPT) system. The vent assembly may include a vent housing having a first orifice configured to receive the flow of pressurized gas from the RPT device and the vent housing having a plurality of holes to discharge pressurized gas to atmosphere; a vent housing connector having a second orifice configured to direct the flow of pressurized gas to the patient interface; and a heat and moisture exchanger (HME) comprising an HME housing and an HME material within the HME housing, wherein the vent housing and the vent housing connector are configured to be connected to, at least in part, form a cavity, and wherein the HME is positioned in the cavity when the vent assembly is assembled.
US11351323B2
A patient interface can have features improving the comfort of use by reducing the perceived pressure of a nose-contacting cushion of the patient interface, against the nose. The patient interface can have rigid headgear connection elements connectable to a frame of the respiratory interface. The rigid headgear connection elements can be shaped to reduce the force of the cushion against the nose. Headgear for a patient interface can also have features improving the stability of headgear of the head. The headgear can have a relatively framework and a relatively pliable overlay covering the framework. The rigid framework can have apertures defining a front portion to be positioned below or near the cheekbones, rear portion to be positioned over the sides of the head around the ears, and a top portion to extend upward along the head towards the crown.
US11351321B2
Apparatus for transporting particles through a patient's trachea into the respiratory system include a delivery tube having at least a ventilation lumen and a particle delivery lumen. The delivery tube has a centering device near its distal tip, such as a balloon eccentrically mounted on the tube to position an outlet of the particle delivery lumen near a centerline of the trachea above the carina branching into the right and left bronchus. A proximal end of the delivery tube connects to a source of particles, and a controller may be provided to adjust a rate and/or an amount of the particles delivered to the patient. In a specific example, frozen particles are delivered to control core body temperature. In other instances, the particle may be a medicament or other substance for effecting other therapies or diagnostic procedures.
US11351319B2
CPAP treatment apparatus is disclosed having a controllable positive airway pressure device. A sensor generates a signal representative of patient respiratory flow that is provided to a controller. The controller is operable to determine the occurrence of an apnea from a reduction in respiratory airflow below a threshold determined from long term ventilation. When an apnea or hypopnea has occurred the calculation of the threshold is suspended until the end of that event.
US11351316B2
A handheld device for dispensing a pharmaceutical substance has a housing in which a storage container with the pharmaceutical substance and a counter are arranged. The storage container dispenses the pharmaceutical substance by pressure actuation by a user after a specified displacement path has been traversed, and the counter carries out an action in order to rotate a counter wheel of the counter on the basis of the displacement path being traversed. The counter additionally has a drive part rotates the counter wheel, and the counter wheel is rotatably attached to a mounting part. The mounting part is formed independently of the housing, and the drive part is directly attached to the mounting part. The handheld device advantageously dispenses a pharmaceutical substance in that the action is first carried out on the counter wheel of the counter upon the pressure actuation, and the pharmaceutical substance is then dispensed.
US11351308B2
A drug delivery device includes a housing defining a shell, a drug delivery assembly at least partially disposed within the housing, a cap defining an opening and being adapted to at least partially cover an end of the housing, at least one electronic component, a power source which powers the at least one electronic component, and a switch assembly. The drug delivery assembly comprises a guard which engages an inner surface of the housing and is movable between a first position, a second position, and a third position relative to the housing and is adapted to restrict external contact with a cannula. The switch assembly causes the power source to provide power to the at least one electronic component when the cap is removed from the housing, restrict the power source from providing power when the cap is coupled to the housing and the guard is in the first position, and cause the power source to provide power when the cap is coupled to the housing and the guard is in the third position.
US11351307B2
A drug delivery system is provided that has an adjustable dose mechanism allowing setting and locking the dose then administration of the set dose. A method for administering a medicament using the drug delivery system is also provided.
US11351303B2
The invention relates to a device for treating an individual suffering from cardiac or circulatory arrest or from a stroke, comprising a blood withdrawal device (BE) that is applied to the individual (P), an analysis unit (BA) which is directly or indirectly connected to the blood withdrawal device for detecting a blood analysis result (BAE) providing at least one characteristic of the blood, directly or indirectly connected to a blood return device (BR) that is applied to the individual (P) and is designed to deliver a substance to the individual via the return device (BR).
US11351302B2
A system for monitoring upstream flow characteristics for a pump is provided. The system may receive one or more outputs from a fluid level sensor coupled with a pump. The system may detect based on at least the one or more outputs, an abnormal upstream flow condition in the pump, such as a full upstream occlusion in the tube, a partial upstream occlusion in the tube, an empty reservoir, and/or a backflow of the fluid into the drip chamber. The system may adjust, based on the detection of an abnormal upstream flow condition in the pump, operation of the pump.
US11351291B2
The invention provides a method and an apparatus or system for dialysis. The method and apparatus or system are useful for removing an undesirable protein-binding substance such as a toxin from a biological fluid such as blood or blood plasma. As such, the method and apparatus or system are useful for treating a subject in need of dialysis such as a subject suffering from hepatic disease. The methods feature a) dialyzing a biological fluid against a dialysis fluid containing an adsorber for a protein-binding substance to be removed through a semipermeable membrane, b) adjusting the dialysis fluid so that the binding affinity of the adsorber for the protein-bound substance to be removed is lowered and the substance to be removed passes into solution, and c) balancing the volume or flow of one or more fluids in the apparatus or system suitable for dialyzing a biological fluid containing a protein-binding substance to be removed. The apparatus or system features a) a biological fluid circuit (3); b) a dialysis fluid circuit (2); c) a means (4; 6; 7; 8; 9) for solubilizing the protein-binding substance to be removed; d) a dialysis, filtration or diafiltration device (5); e) a balancing system or apparatus suitable for balancing the volume or flow of one or more fluids in the apparatus or system suitable for dialyzing a biological fluid containing a protein-binding substance to be removed; and f) a dialysate regeneration unit.
US11351283B2
An intelligent sterilization method and a sterilization container are disclosed, the intelligent sterilization method comprising: after an intelligent sterilization instruction is issued, the sterilization container sequentially performs the following steps: a sterilizing and drying step, releasing sterilization medium and hot air to an article storage cavity containing a sterilized article, and sterilizing and drying the sterilized article; and a constant temperature aseptic storing step, continuously releasing a small amount of hot air and a small amount of sterilization medium to the article storage cavity to maintain the sterilized article in the article storage cavity at a preset constant temperature and an aseptic condition; wherein the constant temperature is defined as when the sterilized article is in contact with the human body, the human body feels warm and not uncomfortable. The sterilization container includes an article storage cavity, an illumination device, a heating air duct, a microprocessor, and a memory.
US11351280B1
A system and method for sanitizing the interior surface of gloves is provided. One embodiment comprises at least one ultra violet (UV) lamp, wherein the at least one UV lamp is sized and shaped to fit within a selected region within an interior of the glove, and wherein the least one UV lamp emits UV radiation at a predefined intensity for a predefined duration that kills at least one consisting of a virus, a bacteria, and a mold that resides on the interior surface of the selected region of the glove.
US11351270B2
Truncated junctophilin-2 related proteins, transcriptional repressor domains, vectors encoding the proteins or domains, and methods of using the proteins and domains, are provided.
US11351267B2
The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the amino acid sequence of (c), wherein the identity determination excludes amino acid position (X6) and provided that the amino acid sequences EVMSTTA (SEQ ID NO: 20) in amino acid positions 12 to 18 of SEQ ID NO: 19 and SQSPH (SEQ ID NO: 21) in amino acid positions 31 to 35 of SEQ ID NO: 19 are conserved and the amino acids Q and Yin amino acid positions 37 and 38 of SEQ ID NO: 19 are conserved.
US11351264B2
This invention is in the field of medicinal pharmacology. In particular, the invention relates to protease activated receptor type 2 (PAR2) modulating compounds (e.g., mimetic peptides), compositions comprising such modulating compounds, and their use as therapeutics for the treatment of conditions involving PAR2 activity.
US11351263B2
Provided herein are nanoplexes comprising a payload selected from a protein and/or a polynucleic acid; and a plurality of copolymers comprising a first copolymer that is poly(N,N′-bis(acryloyl)cystamine-poly(aminoalkyl)) (PBAP), a second copolymer that is poly(C2-3 akylene glycol)-PBAP-poly(C2-3 akylene glycol), and a third copolymer that is TG-poly(C2-3 akylene glycol)-PBAP-poly(C2-3 akylene glycol)-TG wherein TG at each occurrence is independently a targeting ligand, a cell penetrating peptide, an imaging agent or a capping group, provided that a plurality of TG groups is a targeting ligand; wherein the payload is non-covalently complexed to one or more of the copolymers, one or more of the first, second, and/or third copolymers comprises an endosomal escape group having a pKa of about 4.5 to about 6.5, and optionally one or more of the first, second, and/or third copolymers comprises a host and a guest non-covalent crosslinker.
US11351261B2
A composite implant comprising an injectable matrix material which is flowable and settable, and at least one reinforcing element for integration with the injectable matrix material, the at least one reinforcing element adding sufficient strength to the injectable matrix material such that when the composite implant is disposed in a cavity in a bone, the composite implant supports the bone. A method for treating a bone, the method comprising: selecting at least one reinforcing element to be combined with an injectable matrix material so as to together form a composite implant capable of supporting the bone; positioning the at least one reinforcing element in a cavity in the bone; flowing the injectable matrix material into the cavity in the bone so that the injectable matrix material interfaces with the at least one reinforcing element; and transforming the injectable matrix material from a flowable state to a non-flowable state so as to establish a static structure for the composite implant, such that the composite implant supports the adjacent bone.
US11351258B2
Methods and systems for radiation therapy involve administering a payload/combination of biocompatible high-Z and semiconductor NPs to tissue, such as a tumor or an eye. Ionizing radiation may be directed towards the payload, and ionized electrons generate Cerenkov radiation (CR). The CR interacts with semiconductor NPs to produce chemical species that are damaging to cells. The payload may be administered via injection or via a radiotherapy (RT) device that includes NPs in a biodegradable polymer matrix. Biodegradation of the polymer matrix, which results in release of its payload, may be remotely activated using, for example, electromagnetic or sound waves. The payload may include one or more immunologic adjuvants capable of promoting an immunologic response at remote sites (such as a metastatic tumors) that are separate from the site at which the NPs and adjuvants were administered.
US11351251B2
The present invention relates to antibodies that are heterodimeric and bind human PD-L1 and human TIM-3, and may be useful for treating cancer alone and in combination with chemotherapy and other cancer therapeutics.
US11351237B2
A CMV-based vaccine that promotes immune-mediated destruction of cancer through a onetime or repeated intratumoral administration of a recombinant CMV to generate a robust, long-lasting anti-tumor immune response.
US11351215B2
The present disclosure relates to a composition including a Centipeda minima extract and the fraction thereof as an active ingredient. Since the composition of the present disclosure promotes the production and growth of hair, the composition not only presents excellent effects in the prevention, amelioration, and treatment of hair-loss, but may also be used for promoting hair-growth.
US11351214B2
Methods are described herein for making a composition comprising at least one of caffeic acid, monocaffeoylquinic acids, and dicaffeoylquinic acids, and salts thereof.
US11351209B2
The present invention provides a composition comprising a phosphatidylinositol 3-kinase (PI3K) inhibitor and a modified virus for separate, subsequent or simultaneous use in the treatment of cancer, wherein the modified virus is for intravenous administration.
US11351207B2
A composition and method for preventing and/or treating an E. coli-based infection in an animal is described.
US11351195B2
Mitochondrial compositions and therapeutic methods of using same. Compositions of partially purified functional mitochondria and methods of using the compositions to treat conditions which benefit from increased mitochondrial function by administering the compositions to a subject in need thereof.
US11351194B2
The present invention provides a method for proliferating neural progenitor cells and a composition for treating neurological diseases, the composition including a proliferated neural progenitor cell. When a fetal neural progenitor cell is cultured under a hypoxia condition and/or in a medium containing tocoperol, tocoperol acetate, or a mixture thereof, the improved cell proliferation rates of the fetal neural progenitor cell are confirmed. In addition, considering an effect of the neural progenitor cell on preventing differentiation thereof into neurons at the time of proliferation, the present disclosure may contribute to mass production of neural stem cells, and accordingly, the proliferated neural progenitor cell is expected to be utilized in the treatment of a neurological disease.
US11351193B2
The present invention relates to compositions for mineralizing a dental surface, in particular tooth enamel. Methods of mineralizing hypomineralized lesions (including subsurface lesions) in the tooth enamel caused by dental caries, dental corrosion and fluorosis are also provided. In particular, the invention relates to a method of mineralizing a dental surface or subsurface comprising contacting the dental surface or subsurface with a compound that is capable of increasing or maintaining the pH of a solution and a mineralizing agent.
US11351186B2
Cytidine nucleoside analogues of Formula I, wherein the variables are as described herein, in combination with uridine nucleoside analogues of Formula II, wherein the variables are as described herein, produce a synergistic effect on the inhibition of HCV polymerase.
US11351178B2
The present invention relates to novel benzohydroxamic compounds of formula (I) and (II) and pharmaceutically acceptable salts, isomers and prodrugs thereof, exhibiting a high selective inhibitory activity against histone deacetylase 6 (HDAC6) enzyme.
US11351173B2
The invention provides substituted pyrrolo[1,2-a]pyrimidines and related organic compounds, compositions containing such compounds, medical kits, and methods for using such compounds and compositions to treat medical disorders, e.g., Gaucher disease, Parkinson's disease, Lewy body disease, dementia, or multiple system atrophy, in a patient. Exemplary substituted pyrrolo[1,2-a]pyrimidines compounds described herein include substituted 2,4-dimethyl-N-phenylpyrrolo[1,2-a]pyrimidine-8-carboxamide compounds and variants thereof.
US11351165B2
It has been found by the present inventors that agents that boost the expression of the opioid receptor kappa 1 (OPRK1) can enhance the cytotoxicity of chemotherapeutic agents in multiple cancer cell lines. Furthermore, the effect is dose dependent, where the greater the induced expression of OPRK1, the greater the cytotoxicity of the chemotherapeutic agent. The increase in overall cytotoxicity is independent of the cytotoxicity of the agent that increases the expression of OPRK1, which itself has no or minimal cytotoxic effect.
US11351164B2
There are disclosed compounds that modulate or inhibit the enzymatic activity of indoleamine 2,3-dioxygenase (IDO), pharmaceutical compositions containing said compound and methods of treating proliferative disorders, such as cancer, viral infections and/or inflammatory disorders utilizing the compounds of the invention.
US11351156B2
PI3K signalling is the most increased pathway in human cancers. The four isoforms of PI3K are thought to be activated by different redundant mechanisms leading to a common downstream signalling. The inventors questioned this concept, by mapping differential isoform-specific downstream signalling in response to their constant selective inhibition in pancreatic cancer, a disease currently without therapy. They identified common and specific signals activated by each PI3K isoform. These data make the rational for the development of highly selective PI3K isoform drugs used in combination, instead of compounds inhibiting all PI3Ks. In particular, the inventors showed that combined p110a and 110γ inhibition is the most efficient strategy for pancreatic cancer patients.
US11351150B2
Compositions for treating a sleep disorder or modifying or improving the sleep-wake cycle in a subject are disclosed herein. In some examples, the composition can comprise one or more sleep promoting active agents, one or more sleep quality active agents, one or more sleep recovery active agents, and optionally one or more next day active agents. The composition can provide an immediate burst release of the one or more sleep promoting active agents, a delayed burst or delayed sustained release of the one or more sleep quality active agents, a delayed burst or delayed sustained release of the one or more sleep recovery active agents, and a delayed burst or delayed sustained release of the one or more next day active agents. The composition can be provided as a daily oral uni-dosage form. Methods of making and using the compositions are also provided.
US11351149B2
The invention relates to compounds of Formula I″ wherein R, R1, R2, R3, p, q and q′ are as defined herein, pharmaceutical compositions comprising the compounds, methods of treating coronavirus infection such as COVID-19 in a patient by administering therapeutically effective amounts of the compounds, and methods of inhibiting or preventing replication of coronaviruses such as SARS-CoV-2 with the compounds.
US11351146B2
The present invention relates to a composition comprising a combination of a (halogenoacetamido)benzoate, a flavonol and a terpene, and, as example, relates to a composition comprising the combination of ethyl 3-(2-chloroacetamido)benzoate, dihydroquercetin and bisabolol. Said composition is for use in the treatment of leishmaniasis, especially cutaneous or mucosal leishmaniasis, the composition being applied topically for concomitantly treating both parasitic infection and skin inflammation of the infected area induced by leishmaniasis.
US11351143B1
Disclosed are methods for inhibiting the progression of Amyotrophic Lateral Sclerosis (ALS). The methods include administering to a patient suffering from ALS a composition comprising either deuterated linoleic acid or an ester or deuterated arachidonic acid or an ester thereof.
US11351137B2
Chemical compositions and methods of synthesis thereof. The compositions disclosed and described herein are directed toward thyroid hormone αvβ3 integrin receptor antagonists conjugated to targets of the norepinephrine transporter (NET) or the catecholamine transporter. The compositions have a dual targeting effect and increased targeting efficiency in the treatment and diagnostic imaging of neuroendocrine tumors.
US11351136B2
The present invention provides methods, compositions, and kits for treating retinopathy, including diabetic retinopathy and macular degeneration, in a subject in need.
US11351134B2
Active components comprising lauric acid, or a lauric acid derivative, are utilized independently, or in combination, to provide new and useful compositions for bacteriostatic action against susceptible pathogens. The lauric acid derivative includes one or more of 12-aminododecanoic acid, 12-amino-1-dodecanoic acid methyl ester, sucrose monolaurate, 12-(7-nitrobenzofurazan-4-ylamino) dodecanoic acid, 4-nitrophenyl dodecanoate, 1-lauroyl-rac-glycerol, 3-oxo-N-(2-oxocyclohexyl) dodecanamide, butyl laurate, benzyl laurate, isoamyl laurate, monolaurin, isopropyl laurate, pentyl laurate, and hexyl laurate. A preparation includes combining the active component with lecithin, and after an initial processing phase, coating with chitosan or a carrier. Final compositions may be or may contain particles, such as nanoparticles. Final compositions, or formulations containing said final compositions, may be utilized internally, causing one or more membrane changes (e.g., a membrane of an internal target pathogen, which may or may not be an antibiotic-resistant pathogen). At least some compositions inhibit growth of one or more Gram-positive bacterial species and one or more Gram-negative bacterial species.
US11351129B2
The present invention generally relates to systems and methods for treating vitiligo. In one set of embodiments, the present invention comprises a composition comprising pyruvic acid and/or a pyruvate salt. The composition may be formulated for application to the skin of a subject, for instance, as a gel, lotion, cream, ointment, soap, or stick. In some cases, the composition may comprise a lecithin, such as phosphatidylcholine. In certain embodiments, the lecithin is present as a liquid crystal, and/or in liposomes, micelles, or other vesicles. Other aspects of the present invention are generally directed to methods of making or using such compositions, methods of promoting such compositions, kits including such compositions, or the like.
US11351108B2
The present invention relates to a finger-moldable composition capable of forming a free-standing coating and suitable for application to, for example, human lips. The composition includes a thermoplastic block copolymer that includes styrenated blocks. It further includes a sufficient amount of cosmetic oil to allow a human user to mold the composition readily with the user's fingers and form a free-standing film.
US11351100B2
A hair coloring composition may include at least one selected from the group consisting of thioglycolic acid, cysteine, 3-mercapto-1,2 - propanediol, cysteamine, derivatives and salts thereof, and a basic dye, a HC dye, an amino acid, cationic surfactant, thickener, oil agent, pH adjuster, and wetting agent, wherein the pH of the hair coloring agent composition is 3.5 or higher.
US11351091B2
An adapter assembly for establishing bidirectional fluid connection between a cartridge and a vial includes a housing having an open first end adapted to engage the cartridge and a second open end adapted to engage the vial. The adapter includes a needle assembly having a first tip and a second tip, with the needle assembly disposed within the housing and at least partially supported by a needle holder. The needle assembly is movable relative to the housing from an initial position in which the first and second tip are isolated from the cartridge and vial, to an end of use position, in which first tip is engaged with the vial and the second tip is engaged with the cartridge, establishing fluid communication therebetween. The needle assembly is maintained in the initial position by a locking structure which is released by rotationally advancing the needle holder relative to the housing.
US11351086B2
Embodiments of a Cardio-Pulmonary Resuscitation (“CPR”) device are disclosed. A CPR device can include a compression mechanism configured to perform successive CPR compressions on a chest of a patient, the compression mechanism including a support portion configured to be placed underneath a patient, a piston, and a contact surface configured to make contact with the chest at a first orientation with respect to the support portion; and a controller communicatively coupled with the compression mechanism. The controller can be configured to receive at least one input and determine whether the first orientation of the contact surface should be adjusted based on the at least one input. The controller can further, responsive to a determination that the first orientation of the contact surface should be adjusted, cause the contact surface to move so that the contact surface makes contact with the chest at a second orientation with respect to the support portion.
US11351082B2
Proposed is a seating-type gait rehabilitation robot improved in entry characteristics, and more particularly to a seating-type gait rehabilitation robot improved in entry characteristics, of which a structure is concise and simple, and in which a footrest on which a trainee can put his/her foot has the minimum height to allow the trainee to easily enter and readily use the robot without any separate entry means for entry of the trainee and is placed at an entry side for the trainee to raise a gait training effect and reduce a collision risk.
US11351076B2
An air mattress control system is disclosed. The air mattress control system comprises a mattress and a gas regulating device. The mattress comprises a plurality of inflation layers. The gas regulating device comprises a first three-way solenoid valve, a pumping motor, a second three-way solenoid valve, a connecting conduit, a gas guiding device, and a control device. The pumping motor connects the first three-way solenoid valve and the second three-way solenoid valve connects the pumping motor. The connecting conduit connects the first three-way solenoid valve and the second three-way solenoid valve. The gas guiding device connects the connecting conduit and a plurality of the inflation layer. The control device controls the switch of the first three-way solenoid valve and the second three-way solenoid valve, and starting the pumping motor to inflate or deflate the plurality of inflation layers.
US11351073B2
Provided is a robot. The robot includes a main body provided with a traveling wheel, a seat disposed above the main body, a backrest spaced apart from the seat, a link configured to connect the seat to the backrest, a first tilting mechanism embedded in the seat, the first tilting mechanism being configured to tilt the link with respect to the seat, and a second tilting mechanism embedded in the backrest, the second tilting mechanism being configured to tilt the backrest with respect to the link.
US11351058B2
Glaucoma treatment devices are disclosed. In various example, the glaucoma treatment devices include a body and a fluid conduit that are configured to help facilitate evacuation of fluid from a fluid-filled body cavity, and reabsorption of the evacuated aqueous humor by the body through tissue surrounding the glaucoma treatment device. In some examples, the glaucoma treatment device is configured such that a flow resistance through the fluid conduit can be modified post-operatively one or more times.
US11351057B2
Certain aspects of the present disclosure provide a low friction trocar valve comprising a set of sheets arranged circularly and defining an entry point for the insertion of an instrument. In certain aspects, each sheet of the trocar valve's set of sheets comprises areas that overlap with two adjacent sheets. The trocar valve is formed in an opening of a valve housing coupled to or formed as part of a trocar cannula to provide a sealing mechanism for preventing the escape of pressurized fluids from the trocar cannula.
US11351055B2
An ostomy barrier extender includes a skin friendly adhesive layer, a backing layer laminated on a surface of the skin friendly adhesive layer, a release liner laminated on an opposite surface of the skin friendly adhesive layer, at least one perforated feature, an outer periphery, an inner periphery, and a ring shaped body defined between the outer periphery and the inner periphery. The ostomy barrier extender is configured to separate along at least one perforated feature.
US11351054B2
An ostomy appliance includes a multilayer composite film comprising at least one foam layer. An outer foam layer can function as a skin contact layer providing comfort and softness characteristics that are comparable to a nonwoven comfort layer. Preferably, at least one foam layer includes a vinyl-bond rich triblock copolymer and provides sound absorbing properties. The multilayer composite film can also include at least one layer comprising a filler to further enhance sound absorbing properties.
US11351050B2
The present invention is directed toward an intragastric device used to treat obesity that includes a wire mesh structure capable of changing from a compressed pre-deployment shape to an expanded post-deployment shape with a greatly increased volume. The post-deployment shape contains a light weight at the top and a heavier weight at the bottom to ensure proper positioning within the stomach. In the post-deployment shape, the device contains larger spaces in the upper portion and smaller spaces in the lower portion to sequester food and delay gastric emptying. Alternatively, the device can be enveloped by a membrane containing larger holes at the top and smaller holes at the bottom to sequester food and delay gastric emptying. The device has a dynamic weight where the weight of the device in the pre-feeding stage is less than the weight of the device in feeding or post-feeding stage.
US11351045B2
An illustrative stent may comprise an elongated tubular member having a first end and a second end and an intermediate region disposed therebetween. The elongated tubular member may include at least one barb attached thereto. The barb may be configured to be tucked under a filament of the stent during delivery of the stent and protrude radially from the stent, when the stent is deployed.
US11351040B2
The present invention relates to a method of treating a hip joint of a human patient, the hip joint comprising an acetabulum, the acetabulum being a part of the pelvic bone, and a caput femur, the caput femur being the proximal part of the femoral bone, said method comprising the steps of: cutting the skin of the human patient, dissecting an area of the pelvic bone on the opposite side from the acetabulum, creating a hole in said dissected area, said hole passing through the pelvic bone and into the hip joint of the human patient, and performing an action in the hip joint, through said hole in the pelvic bone.
US11351035B2
A method for treating arthritis of a joint includes identifying a bone lesion in a bone adjacent to the joint; and implanting in the bone a reinforcing member in or adjacent to the bone lesion. A kit for conducting the method includes: (a) at least one reinforcing member having a proximal face adapted to face the joint, a distal face adapted to face away from the joint, and a wedge-shaped edge adapted to pierce bone, wherein the at least one reinforcing member is planar and sterile; and (b) a container adapted to maintain the at least one reinforcing member sterile. Another kit includes: (a) a sterile fluid; (b) a syringe for injecting the fluid into a bone; (c) a curing agent adapted to cure the fluid to polymerize and/or cross-link; and (d) a container adapted to maintain the sterility of contents of the container.
US11351033B2
Exemplary embodiments of the present disclosure are directed towards an implantable device for complete replacement of temporomandibular joint comprising of a condyle component to reconstruct a mandibular end of the temporomandibular joint designed for movement within the implantable device with a plate; and a condyle surface where the plate is configured to mechanically secure the condyle component to a ramus surface of a patient undergoing implant with the aid of screws; and the condyle surface polished to generate a mirror effect to reduce the friction in the implantable device and infection rate; a zygomatic arch component to reconstruct a temporal bone (glenoid fossa) of the temporomandibular joint comprising at least one of: a plate; a plurality of multiple threaded counter sink holes; a plurality of conically tapered holes and a zygomatic arch surface, whereby the multiple threaded counter sink holes are structured within the plate; and a fossa component configured to be positioned between the condyle component and the zygomatic arch component to anchor the movement of the temporomandibular joint and the fossa component comprising of a low density biocompatible material made of a polycarbonate which is utilized in the additive manufacturing for the synthesis of implantable device for temporomandibular joint.
US11351029B2
This invention is related to the device used in the valve sparing aortic root replacement which is a special operation aimed at the root of the main vessel—aorta originating from the heart or known as ‘David Procedure’ (Re-implantation technique) in the literature.
US11351025B2
The vascular prosthesis includes a luminal graft component having at least one fenestration. At least one fenestration ring borders the at least one fenestration and is fixed to the luminal graft component. The fenestration ring includes a main component with two opposing ends and a connecting component. The diameter of the fenestration ring can expand upon insertion of a branch prosthesis through the fenestration ring during implantation at a surgical site. The vascular prosthesis can be implanted in a patient to thereby treat, for example, an arterial aneurysm, spanning a region of an aneurysm that includes at least one arterial branch.
US11351024B2
An airway support device of the present disclosure can be attached to tracheal and/or bronchial cartilage on opposing sides of a tracheal and/or bronchial wall to pull the tracheal and/or bronchial cartilages toward each other to reconstruct and/or reshape to a normal anatomy across the membranous tracheal and/or bronchial wall and thus relieving tension across the tracheal and/or bronchial wall. The airway support device can include at least two longitudinal strips that extend longitudinally along and are attached (e.g., sutured) to the trachea and/or bronchus on opposite sides of the tracheal and/or bronchial wall. Pairs of lateral strips extending from each of the longitudinal strips can be attached to each other under tension. The tracheal and/or bronchial wall can be attached (e.g., sutured) to the lateral strips to open the airway of the trachea and/or bronchus.
US11351011B1
Methods, systems, and apparatuses are described for generating a digital model of a tooth structure for a gap between neighboring teeth of an arch form of a patient. Position of a tooth structure between neighboring teeth may be determined. Arch lines extending through the plurality of teeth may be determined. Intermediate points in the interdental gap may be determined. Longitudinal axis of the tooth structure relative to the neighbouring teeth may be derived. A digital model of the tooth structure may be aligned on the longitudinal axis and a digital model of the tooth structure may be obtained.
US11351009B2
The present invention relates to methods for the restoration of a decayed portion of a tooth or re-restoration of a previously filled tooth, and to dental capsules and dental composite resin dispensers that may be used in the methods for the restoration of a decayed portion of a tooth.
US11351008B2
Markers, microwave probes, and related systems and methods are provided for localizing lesions within a patient's body, e.g., within a breast. The marker includes an energy converter e.g., one or more photodiodes, for transforming energy pulses striking the marker into electrical energy, a switch, e.g., FET, coupled to the photodiodes such that light from a probe cause the switch to open and close. A pair of antenna wires are coupled to the switch to provide an antenna, the switch configured to open and close when light strikes the photodiodes to modulate signals from the probe reflected by the antenna back to the probe to identify the location of the marker. The marker also includes an electro static discharge (ESD) protection device coupled to the switch to provide protection against an electrostatic discharge event.
US11351007B1
Aspects of the present disclosure include surgical systems that provide a cost-effective, accurate, and efficient system for performing surgical procedures. In one aspect of the disclosure, a surgical system utilizes an intra-operative 3D scanner that can be used to determine anatomical landmarks and calculate surgical positions based on such anatomical landmarks. In some examples, aspects of the present disclosure also include providing guidance information for guiding the placement of a surgical instrument according to the calculated surgical positions.
US11350994B2
Technologies for providing assistance to a surgeon during a surgical procedure are disclosed. An example method includes identifying a medical condition of a patient and recommending surgical procedures for treatment. An optimal surgical procedure is then determined based on correlations between the medical condition of the patient and outcomes of previous surgical procedures for other patients previously suffering from the medical condition. A 3D model of the patient may be created using current images of an affected area of the patient. Successively, a surgeon is trained using a Virtual Reality simulation. During the training, the surgeon may be allowed to provide annotations. Further, the recommended surgical procedures are based on medical data of the patient, including medical images. Surgical paths are retrieved for addressing the surgical need of the patient, and the surgical paths may be overlaid on image segments, for display for the surgeon. A surgical path is selected from the surgical paths, a surgical step belonging to the surgical path is selected, and an image segment selected from the image segments, based on the surgeon's inputs is used to create the surgical plan.
US11350990B2
A balloon for renal nerve modulation is disclosed. The balloon may include a polymer material forming a balloon wall having an outer surface and flexible circuits comprising a base selectively adhered to the exterior surface of the balloon wall. Adhesive is selectively applied to the outer surface of the balloon, to the flexible circuit or to both such that the adhesive is selectively deposited on the at least a portion of the at least two pads or on the at least a portion of the at least two pads and to a portion of the distal spline. The portion of the at least two pads or the portion of the at least two pads and a portion of the distal spline are adhered to the outer surface of the balloon and a remainder of the flexible circuit moves freely with respect to the outer surface of the balloon.
US11350975B2
A distal radius fixation plate for volar plating may comprise a distal radius fixation plate body configured to be placed adjacent a fractured volar distal radius and proximal to a watershed line of the volar distal radius and a distal radius fixation plate extension approximately 60 to 80% thinner on average than the distal radius fixation plate and projecting from the distal radius fixation plate body and configured to be placed so that it extends distal to the watershed line, the plate extension configured to curve around an ulnar/volar corner of the distal radius bone so as to engage the volar lip preferably without curving around other parts of the volar lip of the distal radius. The plate extension may have a hook at its upper end. The plate body may have an obliquely angled screw hole to buttress a radial styloid fragment.
US11350973B2
A rod reducer including a housing defining an opening, a body member defining an opening and a slot, a shaft disposed through the opening of the housing and coupled to the opening of the body member, an anvil including a linkage extending therefrom, the linkage coupled to the body member and the anvil, a plurality of arm members, and a biasing element disposed between the body member and the anvil. A pin of the linkage is slidably disposed within the slot, and the biasing element is configured to bias the anvil distally with respect to the body member. Rotation of the shaft translates into linear movement, relative to the housing, of the shaft, the body member, and the anvil. The arm members are coupled to the housing and movable towards a parallel configuration as the anvil is advanced away from the housing to engage a bone screw.
US11350971B2
An anchoring system for implanting in bone, the system comprising a first coupling assembly having a first clamp and a first coupling body that receives and holds a first stabilization element; a second coupling assembly that receives and holds a second stabilization element; and a plate that attaches to the first coupling assembly and the second coupling assembly, wherein the first coupling assembly attaches to a bone fastener, and wherein the first coupling body includes a cap retainer that receives a locking cap that applies a directional force to force the first coupling body toward the plate, and applies another directional force to force the first clamp toward the plate, thereby fixedly securing the first coupling body and the first clamp to the plate.
US11350968B2
A modular polyaxial bone screw includes a poly-axial bone screw, a polyaxial tulip head, and a collet disposed within the tulip head, the collet interacting with the bone screw and tulip head providing an interference fit with the bone screw head to lock orientation of the tulip head on and relative to the bone screw. Inner configurations of the tulip head interact with outer configurations of the collet to lock axial and/or rotational position of the collet within and relative to the tulip head, and thus about the bone screw head. The collet also has a resilient, tapered base with a plurality of slots in and about its end that allow the end to splay outwardly over and upon the head of the bone screw to create a snap or frictional interference fit between the splayed collet and the bone screw head when a spine rod is fixed in the tulip head.
US11350964B2
Prostate treatment using fluid stream to resect prostate tissue, thereby relieving symptoms of conditions such as BPH, prostatitis, and prostatic carcinoma. A device having a fluid delivery element is positioned within a lumen of the urethra within the prostate. A fluid stream is directed outwardly from the fluid delivery element toward a wall of the urethral lumen. The fluid delivery element is moved to scan the fluid stream over the wall to remove a volume of tissue surrounding the lumen. The fluid may be combined with therapeutically active substances or with substances that increase resection efficiency. Fluid force may be adjusted to provide selective tissue resection such that soft tissue is removed while harder tissue is left undamaged. In order to gain a working space within the urethra, another fluid may be introduced to insufflate the urethra in the region of treatment.
US11350963B2
An apparatus is configured to provide hemostasis with tissue removal in order to inhibit one or more of blood loss or tissue drainage. In many embodiments, a nozzle releases a liquid jet in a liquid medium in order to provide cavitation and a plurality of shedding pulses. The liquid jet, its cavitation and the plurality of shedding pulses can affect vascular tissue in order to promote clotting in order to inhibit bleeding. In many embodiments, vessels of the vascular tissue are affected at a distance from a region where cavitation of the water jet contacts the tissue. In many embodiments, the cavitation and plurality of shedding pules are related to a pulsatile shear wave propagating along the blood vessel that is related to clot promoting changes of the blood vessel.
US11350955B2
An intravascular articulating retrieval apparatus may be used to move objects within the vasculature, such as to remove an intravascular filter, tissue and other items from the vasculature. The apparatus has a user interface to manipulate a first and second actuating portion that are coupled to the distal end of the apparatus conduit. A retrieval apparatus may include forceps coupled to the second actuating portion whereby the retrieval actuator opens and closes the forceps for retrieval of an IVF or other device, such as stent or stent graft. An intravascular articulating retrieval apparatus may be used to dissect thrombus from the interior of the vascular wall, move a stent or remove a portion of a stent or stent graft to provide better blood flow or to allow blood flow into a branched vessel.
US11350953B2
A device for fracturing calcifications in heart valves includes a tube formed with at least two longitudinal slits that form at least two struts. Each of the struts includes two or more pairs of notches formed on opposite sides of the strut. The struts have a contracted orientation in which the struts are not expanded outwards from the tube and an outwardly expanded orientation in which the struts are expanded outwards from the tube and have sufficient strength and rigidity to impact and fracture a calcification in a heart valve.
US11350948B2
Embodiments of devices for converting continuous rotational motion into oscillating motion are disclosed herein. In one embodiment, an oscillation device can include an input shaft that rotates about a first axis, a portion of the input shaft defining an eccentric section that defines a second central axis offset from the first axis, a connector rotatably coupled around the eccentric section, an oscillating shaft offset from the input shaft that rotates about a third axis, and a pin coupled to the oscillating shaft and extending towards the connector. The connector includes a sleeve slidably receiving an end of the pin, and continuous rotation of the input shaft about the first axis causes an eccentric movement of the connector, and the eccentric movement of the connector oscillates the sleeve along the pin and oscillates the pin with respect to the oscillating shaft, thereby oscillating the oscillating shaft about the third axis.
US11350927B2
A suturing device for minimally invasive surgery is disclosed. The suturing device has a head defining one or more ferrule holders and a tissue bite area. The device also has a first needle comprising a flywheel portion and one or more curved arms extending from the flywheel portion, each of the one or more curved arms comprising a ferrule engaging tip, wherein the first needle is pivotably coupled to the head. The suturing device further has a first actuator coupled to the first needle and configured to rotate it from a retracted position, where the ferrule engaging tip of each of the one or more curved arms starts away from the one or more ferrule holders, through the tissue bite area, and to an engaged position where the ferrule engaging tip of each of the one or more curved arms is operationally aligned with the one or more ferrule holders.
US11350924B2
An apparatus and methods are provided for a suture anchor to fixate sutures and tissue to bone. The suture anchor comprises an elongate member to be inserted into a bone hole. Barbs along the length of the elongate member engage with an inner wall of the bone hole. An eyelet in a distal aspect of the elongate member is configured to receive a suture. First and second channels extend helically along opposite sides of the elongate member. The eyelet includes first and second openings on opposite sides of the distal aspect. The first opening and the first channel enable applying tension to the suture after implantation into the bone hole. The second opening enables placing the suture into a final position along the barbs after implantation into the bone hole. A proximal aspect of the elongate member receives an instrument for implanting the suture anchor into the bone hole.
US11350922B1
A surgical device includes at least one retractor blade. Each retractor blade includes a blade body having a lateral side, a medial side opposite the lateral side and a bottom end. The bottom end has an inverted-arch curvature. The inverted-arch curvature includes a lowest point in proximity to a midline of the blade body. Each retractor blade includes a connector integrated into a mid-section on the medial side of the blade body and a leg interface configured to mate and/or pair with a leg of a distractor. The at least one retractor blade may include two retractor blades configured as mirror images of each other. Each blade is configured to pair with a respective one distractor.
US11350919B2
Disclosed are puncture sealing systems and methods of locating a puncture site within a vessel. The systems can include elongated dilators and access sheaths that are configured to locate the puncture site within a vessel so that the position of the puncture site relative to a distal end of the access sheath is known during a puncture sealing procedure.
US11350917B2
A device for delivering an implant to a surgical location of a patient is provided. In some embodiments, an example device includes a polymer body having first and second tapered sections and a sealed cavity defined by the polymer body. The polymer body is separable between the first and second tapered sections.
US11350915B2
A surgical stapler including a shipping lock configured to obstruct movement of a drive member is provided. The surgical stapler includes an elongate body, a tool assembly pivotally secured to the elongate body, a drive member movable within the tool assembly between retracted and advanced positions, and a shipping lock releasably secured to the elongate body. The shipping lock includes a projection. When the shipping lock is secured to the elongate body, the projection obstructs movement of the drive member to its advanced position.
US11350914B2
An improved flexible endoscopic instrument to precisely and efficiently obtains samples of flat polyps and multiple polyps from a patient by debriding one or more polyps and retrieving the debrided polyps without having to alternate between using a separate cutting tool and a separate sample retrieving tool and may be used with an endoscope. In one aspect, the cutting tool is coupled to a flexible torque coil or torque rope that is configured to transfer rotational energy from a powered actuator through the length of the endoscope onto the cutting tool.
US11350913B2
A kit and a method are disclosed for collecting and preparing a biological sample for testing where the sample is to be mixed with a buffer prior to being tested.
US11350906B2
The invention relates to an apparatus for in vivo imaging. More specifically, the present invention relates to a catheter that incorporates an Optical Coherence Tomography (OCT) system and an Intravascular Ultrasound (“IVUS) system for concurrent imaging of luminal systems, such as imaging the vasculature system, including, without limitation, cardiac vasculature, peripheral vasculature and neural vasculature.
US11350893B2
The present invention is disclosing several methods related to intra-body navigation of radiopaque instrument through natural body cavities. One of the methods is disclosing the pose estimation of the imaging device using multiple images of radiopaque instrument acquired in the different poses of imaging device and previously acquired imaging. The other method allows to resolve the radiopaque instrument localization ambiguity using several approaches, such as radiopaque markers and instrument trajectory tracking.
US11350875B2
A wearable device may be provided for detecting cumulative alcohol consumption. Such a wearable device may include an adhesive layer that adheres to skin and that allows sweat from the skin to pass through and a customizable ink layer that reacts irreversibly to change color along a gradient as ethanol is detected in the sweat. The customizable ink continues to increase color intensity along the gradient as ethanol continues to be detected in the sweat over time.
US11350874B2
A device that may include, or communicate with, sensors such as an electrocardiogram (ECG) sensor, an accelerometer, and/or a photoplethysmograph (PPG) detects sleep-disordered breathing (SDB) events of a patient based on signals from the sensors. The device may have a processor configured to make the detection(s). In an example, the processor may access a memory with processor control instructions. The instructions may be adapted to configure the processor to carry out the detection methodology. The method may include analysing an ECG data of the patient from a signal generated by the ECG sensor, pulse oximetry data of the patient from a signal generated by the PPG, and a three-dimensional (3D) accelerometry data of the patient from a signal generated by the accelerometer to detect the SDB events. The device and methods may be used for screening, diagnosis and monitoring of respiratory disorders.
US11350872B1
A system for predicting an occurrence of a foot ulcer includes a mat configured to be stood upon by a human subject, a plurality of sensor arrays disposed on or in said mat and arranged in adjacent proximity to one another. Each sensor includes an oxygenation probe, itself including a first light source and a light detector, and a secondary probe operable to utilize the light detector of the oxygenation probe and itself including a plurality of light sources exclusive of the first light source. The plurality of light sources of the secondary probe are arranged in a pattern around the oxygenation probe. The oxygenation probe is located at the approximate geometric center of the pattern. The system further includes a control module in signal communication with the light detector, and configured to independently control emission of light from the first light source of the oxygenation probe and the plurality of light sources of the secondary probe.
US11350870B2
This disclosure provides methods, reagents, and diagnostic and prognostic markers useful for non-invasive identification, diagnosis, and therapeutic intervention in individuals with epilepsy. More particularly, the disclosure uses specific metabolites measured by magnetic resonance spectroscopy in brain tissue to detect epileptic brain regions.
US11350866B2
A read-out circuitry for acquiring a multi-channel biopotential signal, comprises: a plurality of read-out signal channels, each receiving an input signal from a unique signal electrode; a reference channel receiving a reference signal from a reference electrode; wherein each read-out signal channel and the reference channel comprises a channel amplifier connected to receive the input signal in a first input node and with an output node connected to a second input node via a channel feedback loop; wherein each signal channel amplifier comprises a capacitor between the second input nodes of the signal channel amplifier and the reference channel amplifier, and wherein each signal channel feedback loop and the reference channel feedback loop comprise a filter.
US11350859B2
Presented are concepts for monitoring cardio-respiratory function of a patient. One such concept employs an optical sensor unit (10) for sensing light from tissue of the patient in response to temporary airway pressure changes provided via a respiratory support unit (50). By sensing variations in blood volume in the central site vein in response to temporary airway pressure changes, venous information of the person may be obtained.
US11350856B2
This electronic device includes a sensor that acquires a pulse wave of a subject, and a controller that estimates the blood glucose level of the subject on the basis of an estimation expression that is created on the basis of a blood glucose level and a pulse wave corresponding to the blood glucose level, and the pulse wave of the subject acquired by the sensor.
US11350854B2
An augmented neuromuscular training system and method for providing feedback to a user in order to reduce movement deficits associated with injury risk, prior injury or disease pathology.
US11350842B2
An electromagnetic tomographic scanner, for use in imaging a live human body part, includes an imaging chamber, a plurality of antennas, a controller, a lid, and a quantity of matching media. The imaging chamber is supported on the base, defines an imaging domain in that receives the head, and has an open end. The antennas are supported by the imaging chamber and encircle the imaging domain. The controller controls one or more antenna. The lid is attachable to the open end and includes a hollow boundary model that mimics a part of human anatomy that is outside the imaging domain. The matching media fills the interior of the model while an empty field measurement is carried out. Various tensors may be produced.
US11350836B2
A current cancellation circuit, a heart rate detection device and a wearable device. The current cancellation circuit includes: a current-voltage conversion circuit and a SAR ADC, where the SAR ADC includes a DAC, an SAR logic circuit and a comparator; the current-voltage conversion circuit is configured to receive an analog current output by the DAC and an interference current output by a photoelectric sensor, calculate a difference between the analog current and the interference current, and output an analog voltage; the comparator is configured to receive the analog voltage output by the current-voltage conversion circuit, and output a comparison result according to the analog voltage; and the DAC is configured to output the analog current according to a digital signal corresponding to the comparison result that is output by the SAR logic circuit, and the analog current is used to cancel the interference current output by the photoelectric sensor.
US11350831B2
An earpiece module includes a physiological sensor, an external energy sensor, a transceiver, a communication module, a data storage component, and a power source. The communication module includes a microphone, a speaker, and a signal processor. The signal processor processes audio information received from a remote source via the transceiver and communicates the processed audio information to a subject via the speaker. The signal processor processes information in real time from the physiological sensor and the external energy sensor, and the signal processor provides biofeedback to the subject based on signals produced by the physiological sensor. The data storage component includes a plurality of algorithms. At least one algorithm focuses processing resources on extracting physiological information from the physiological sensor, at least one algorithm is configured to be modified or uploaded wirelessly via the transceiver, and at least one algorithm is a compression/decompression (CODEC) algorithm.
US11350825B2
A contactless system for measuring and continuously monitoring arterial blood pressure includes a light source configured to illuminate light having at least one predetermined wavelength at a predetermined area of a human subject having an artery therein. A detector responsive to reflected light from the predetermined area to continuously acquire images of the artery in the predetermined area. A processor processes the images and determines when an image at a proximal location of the predetermined area is darker indicating transition of a pulse wave into the artery at the proximal location and at a proximal time and when an image at a distal location of the predetermined area is darker indicating transition of the pulse wave into the artery at a distal location at a distal time to contactlessly and continuously calculate the arterial blood pressure for each cardiac cycle of the human subject.
US11350824B2
A medical image diagnosis apparatus according to an embodiment includes an imager, a storage, and processing circuitry. The storage stores therein a correspondence relationship between each of disease patterns and scans used for performing a differential diagnosis process on the disease pattern. The processing circuitry obtains, based on image data acquired by a first scan, a disease pattern having a possibility of being applicable to the subject and a first index value indicating a degree of applicability of the disease pattern. The processing circuitry outputs information indicating the disease pattern to a display when it is possible to perform the differential diagnosis process based on the first index value and outputs an imaging condition used for performing a second scan based on the correspondence relationship and the disease pattern having the possibility when it is not possible to perform the differential diagnosis process based on the first index value.
US11350823B2
An electronic apparatus according to various embodiments of the present disclosure may comprise: a sensor unit for sensing the movement of the electronic apparatus; a communication unit for communicating with an external apparatus; an input unit for receiving a user input; an output unit for providing information to a user; and a control unit for outputting a message inducing a particular action to the user through the output unit on the basis of medical information of the user and the movement of the electronic apparatus, or controlling the communication unit to transmit information related to the electronic apparatus to an external apparatus.
US11350819B2
An endoscope system includes an endoscope including a control section, an insertion section, and a light guide member, a light source configured to emit light guided by the light guide member, a failure-cause detecting circuit configured to detect a pre-failure state that causes a failure of the endoscope, and a light source controller configured to control an output of the light source based on a detection result of the failure-cause detecting circuit. The failure-cause detecting circuit includes a cause predicting circuit configured to detect a second pre-failure state in which it is predicted that the endoscope reaches a first pre-failure state that directly causes the failure of the endoscope. The light source controller controls the output of the light source based on a detection result of the cause predicting circuit.
US11350816B2
An endoscopic system includes a single-use portion and a multiple-use portion. The two portions can be mated and un-mated. The single-use portion includes an elongated cannula that has a bendable section near its distal end providing a “steerable” distal tip. The distal tip includes LED illumination and an imaging module that feeds live video to a display screen forming which forms part of the multiple-use portion. Ergonomically designed steering control and significant portions of the steering structure reside in the multiple-use portion. The cannula is configured to rotate, which further expands the field of view when combined with steering deflection along a single axis. Some embodiments, include motorized distal tip deflection and/or omni-directional tip deflection.
US11350805B2
Proposed is to a window cleaning tool including an internal unit or including an internal unit and an external unit. The window cleaning tool is configured to prevent an external unit from separating and falling, and to realize smooth movement of a cleaner during washing because when an internal unit moves up, the front end of an internal unit blade rotates away from an inner surface of glass and the front end of an external unit blade rotates away from an outer surface of the glass, and when the internal unit moves down, the front ends of the internal unit blade and the external unit blade rotate toward the surfaces of the glass to be pressed.
US11350802B2
A package or pouch comprising one or more panel portions and a reclosure device. The reclosure device is provided to extend outward from a panel portion of the package to facilitate the use of the package to store and dispense wet wipes and like products.
US11350799B2
The present application provides a towel dryer comprising a main machine, the main machine comprises a shell, a heater mounted in the shell and a fan mounted in the shell, an air outlet is arranged at a bottom of the shell corresponding to an outlet of the fan, and an air inlet is arranged at the bottom of the shell, and the heater is arranged on an airflow path of the fan, wherein the main machine further comprises a wind guide window mounted in the air outlet, and the wind guide window comprises a number of vertical air guide vanes configured to guide airflow to flow vertically downward and a number of inclined air guide vanes configured to guide the airflow to flow obliquely downward in a direction far away from the vertical air guide vanes.
US11350795B2
A food delivery system configured for transportation of a food product from a production site to a consumer site is disclosed having a chamber configured for housing a packaged ready-to-eat meal. The chamber defines an internal environment wherein the food product is received. The system also includes environmental temperature and humidity sensors associated with the chamber, one or more conditioning devices, associated with the chamber in such a way to condition one or more parameters of said internal environment, and a control unit, configured so that the parameters of the internal environment are continuously and adaptively adjusted so as to preserve the food product between the production site and the consumer site.
US11350781B2
A hand-held or table-mounted tool for adhering a flooring edge finish to a flooring edge. The hand-held tool includes a main body, which can include a handle, a base, and a bi-level soleplate, which is heated during application to adhere a flooring edge finish to a flooring edge. The soleplate of the tool can be made of polymer, carbon, metal, ceramic, glass, or a mixture thereof.
US11350779B2
The present invention broadly relates to trays, tables, and storage compartments capable of securely holding glasses and other containers for beverages and other liquids. For example, the trays, tables, and storage compartments may include a retainer portion with a retainer that is adapted to flex to receive a portion of a glass or other container for a beverage or other liquid. The flexing of the retainer also applies a gripping friction force to securely hold the glass or other container.
US11350777B2
An assisted eating aid for use with an eating utensil constructed to carry food portions is disclosed as a serving vessel body having a bottom surface and an opposing upper surface with a centrally disposed food receiving region, an outermost perimeter, and a plurality of flanges projecting upwardly from the upper surface of the serving vessel body to divide the centrally disposed food receiving region from an outermost food receiving region where at least two of the flanges are spaced apart with each flange having an interior facing scoop surface and exterior facing scoop surface constructed to shove food portions pushed thereagainst onto the eating utensil.
US11350773B2
The invention relates to a lighting device, a lighting system and a lighting method. The lighting device comprises a row of lighting units mounted in a first direction X on an elongated carrier wherein each lighting unit is mounted with a respective, fixed, unique, pre-determined orientation. Said lighting device is configured to directly project on a target plane P a row of light patches, said plane P extending in said first direction X and in a second direction Y transverse to said first direction. Said row of light patches extends in the second direction and wherein said lighting device is offset out of said plane P in a third direction Z. The lighting system comprises at least a first and at least one second lighting device substantially lying in line in the length direction. Optionally said first and at least one second lighting device may extend in two or three parallel rows. Said lighting system further optionally comprises a control unit for individual control/addressing of the lighting units of the at least first and further lighting device.
US11350770B2
Various embodiments of the present disclosure provide a storage, shipping, and display unit that can be loaded with product, shipped after loading, and used as a display unit after shipment.
US11350765B2
A multi-functional baby bed includes a left support frame, a right support frame, a swing frame and a cradle frame. The swing frame and the cradle frame are provided between the left support frame and the right support frame. The swing frame is pivotably connected to the left support frame and the right support frame. The swing frame and the cradle frame are detachably connected. The left and right support frames are structurally the same and oppositely disposed. The top of each of the left and right support frame has a rotating device configured to control the movement of the swing frame. The rotating device can be rotated 90°. When the swing frame is fixed, the cradle frame is fixed accordingly and the device may function as a bed. When the swing frame swings, the cradle frame swings accordingly, thus functioning as a cradle.
US11350764B2
A compact baby care system includes a baby crib assembly, at least one sliding storage drawer, and at least one utility cabinet. The baby crib assembly includes a left side panel, an opposing right side panel, a bottom panel, and opposing top and bottom horizontal rails extending between the left side panel and the opposing right side panel. The bottom panel is horizontally secured between the left panel and the opposing right panel. The bottom panel is configured to support a mattress. The at least one sliding storage drawer is underneath the bottom panel of the baby crib assembly. The at least one utility cabinet is attached to the left side panel or the opposing right side panel of the baby crib assembly via a connector. The at least one utility cabinet stores at least one of a feeding station and a changing station.
US11350760B1
The present bed rail with offset rails includes a rail portion swingably engaged to first and second leg portions about first and second axis. The rail portion includes first and second end frame portions extending from the first and second axis and defining a plane having a front face and a rear face. The rail portion includes an offset frame portion disposed forwardly of the front face of the plane and spaced from the front face of the plane.
US11350750B2
A tilt mechanism for a chair comprises a base, a first support configured to support a chair seat and mounted to the base, a second support configured to support a chair back and pivotably coupled to the base about the first pivot axis, a link element pivotably coupled to the second support about a second pivot axis, and a shaft attached to the first support. A first guide slot is provided at the base and a second guide slot is provided at the link element. The shaft is supported in the first guide slot and the second guide slot.
US11350749B2
A modular furniture seat assembly comprises a seating portion having a front end, a rear end, a pair of opposing side edges, and a seating connector component on each of the opposing side edges. A back portion is provided and has a lower end, an upper end, and a pair of opposing side edges. The lower end of the back portion connects to the rear end of the seating portion. A pair of lateral support arm assemblies is provided, each having an inner surface and an outer surface, with each of the pair of lateral support arm assemblies having a first arm connector component which is releasably connectable to the seating connector component. The lateral support arm assemblies comprise an armrest portion and a leg portion, with the leg portion supporting the modular furniture seating item when it is an assembled condition.
US11350746B1
A bullet resistant protective shield for a desk. The protective shield comprises a shield piece having a first channel coupling mechanism. The first channel coupling includes a substantially horizontal element and a substantially vertical element. The first channel coupling mechanism corresponds to a second channel coupling mechanism on a desktop, which also has a horizontal element and a vertical element. The first horizontal element and the first vertical element define a first channel and the second horizontal element and the second vertical element define a second channel. The first vertical element can be placed in the second channel and the second vertical element can be placed in the first channel thereby removably securing the shield piece to the desktop.
US11350728B1
A connector for an electric toothbrush to mount a toothbrush head with an electric toothbrush handle of the electric toothbrush is provided. The connector includes a body configured to be received in an opening of the toothbrush head. The body includes a first section, a second section, and a third section extending one above the other, and includes a seating profile, an aperture, and a biasing member. The seating profile is defined at adjoining of the second and third sections. The aperture is formed inside of the body to receive a drive shaft of the electric toothbrush handle. Further, the biasing member is received along the third section and rests on the seating profile, and operatively coordinates with a threaded profile and a flexible profile of the third section to facilitates snugly coupling of the toothbrush head with the electric toothbrush handle of the electric toothbrush.
US11350727B1
A bag gripping device includes a flexible bag gripping member having a top end portion, a bottom end portion, and first and second side end portions. The flexible bag gripping member includes first and second primary surfaces. The device includes a flexible hand-strap member having first and second end portions. The first end portion is coupled to the first primary surface at the first side end portion. The second end portion is coupled to the first primary surface at the second side end portion. The device includes a first hook-and-loop portion that is coupled to the first primary surface at the bottom end portion. The device includes a second hook-and-loop portion that is coupled to the second primary surface at the top end portion and is removably coupled to the first hook-and-loop portion such that the flexible bag gripping member holds a handle of a bag thereon.
US11350719B2
A hair styling aid for curling hair is described, including a housing, guide means comprising a slot in a wall of the housing for receiving a length of hair to be styled, a rotatable element rotatable clockwise or anticlockwise relative to the housing and the guide means, to form curls, and a heated elongate member around which the length of hair is wound by the rotatable element, in use. The housing surrounds a part of the elongate member to form a chamber between the housing wall(s) and the elongate member, the housing extending from and being integral with a handle. The rotatable element is rotatable relative to or with the elongate member, having a predefined starting position to which it is automatically returned after use. The housing has a longitudinal axis and the slot is parallel with the longitudinal axis of the housing.
US11350715B2
Case for containing an item and method of manufacture comprising: a first panel having a perimeter edge and at least one hinge for folding the first panel. A second panel having a perimeter edge and at least one hinge for folding the second panel. A side panel. A first fastener configured to attach the side panel to the perimeter edge of the first panel. A second fastener configured to attach the side panel to the perimeter edge of the second panel. Method of manufacture of a layered material comprising the steps of: placing a substrate between a first and a second layer of self-reinforced polypropylene (srPP). Bonding the layers of srPP and substrate by: stitching, or riveting through the first layer of srPP, the substrate and the second layer of srPP; or gluing the first layer of srPP, the substrate and the second layer of srPP together.
US11350714B2
The article of luggage includes a luggage main body having a bottom surface and a cavity formed to receive articles for packing; an expansion body having a perimeter defining a cavity; a foldable gusset joining the luggage main body to the expansion body; and an expansion and locking device disposed internally at opposite ends of the article of luggage. The expansion and locking device is configured to allow free movement of the expansion body in a compression direction towards the luggage main body and configured to allow locking movement of the expansion body in an expanding direction away from the luggage main body. One expansion and locking device is preferably attached to two or more walls of the luggage. After finishing packing, the luggage is closed and the user pushes the expanding member towards the base member, ratcheting the pawl past the ratchet teeth to collapse the luggage.
US11350706B2
A securement for zippered luggage, including a housing to substantially cover a pair of sliders of a zipper of the luggage and to prevent movement of the sliders along a tape of the zipper, the housing being formed of a first part which receives the sliders and a second part which engages the first part to substantially encapsulate and prevent movement of the sliders, wherein the first and second parts are secured together in the inoperative securing condition by an element which requires breaking or permanent deformation to permit displacement of the second part to allow movement of the sliders.
US11350704B2
A footwear customization kit includes a container including an article of footwear, a stand, a steaming bag and a set of instructions. The article of footwear includes one or more customizable portions that can be deformed when heated, including an upper and a customizable insert. The stand and the steaming bag can be used to heat the article of footwear and the customizable portions in a steam environment. The customizable portions can be modified by a shape of a foot inserted into the article of footwear and can permanently retain the shape upon cooling.
US11350699B2
Orthotic devices for providing arch support for the foot are disclosed. The orthotic device includes a base member, an arch support portion, and a covering for coupling the arch support portion to the base member. A method of providing continuous contact with the plantar surface of the foot during all phases of the gait cycle is also disclosed. In addition, methods of assembling and using the orthotic device are also disclosed.
US11350698B2
An interchangeable shoe. The interchangeable shoe includes a base, where the base includes a footbed, and an upper. The interchangeable shoe also includes an attachment, where the attachment releasably attaches the upper to the base, The attachment includes a groove in the footbed and a rail attached to the upper, where the rail is configured to be inserted into or removed from the groove.
US11350693B2
An article of apparel, a system, and methods include a structural material configured to enable the article of footwear to the worn on a body. A wireless transmission circuit is included and a piezoelectric generator is positioned with respect to the structural material in a configuration to be flexed to induce a voltage signal output. A voltage sensor is configured to sense the voltage profile and output a sensor signal indicative of the voltage profile. An electronic data storage, coupled to the voltage sensor, is configured to store voltage profile information based on the sensor data. A comparator, coupled to the electronic data storage, is configured to identify a change in the voltage profile information over time. The wireless transmission circuit is configured to transmit data indicative of a physical status of the article of footwear based on the change in the voltage profile information over time.
US11350692B2
A system includes an article of footwear and a remote system. The article of footwear includes an adaptive configured to be adjusted to one of a plurality of configurations based on a command received from a processor circuit. The remote system includes an electronic data storage, configured to store a user profile including the plurality of configurations, and a processor configured to prompt, on a user interface, a user to put on the article of footwear, receive, via a wireless transceiver, a signal from the article of footwear indicating that the article of footwear has been placed on the foot of a wearer, access, one of the plurality of configurations based on a user selection, and transmit the one of the plurality of configurations as selected. The processor circuit causes the adaptive component to be configured according to the one of the plurality of configurations.
US11350688B2
Protective goggles for human use including a pair of protective goggles for human use with at least one lens, an upper edge that is positioned against the user's forehead and a lower edge that is positioned against the user's cheek. Each of the user's eyes are covered by a separate section of lens and each of these sections extends along at least one line of curvature. It is intended that each lens section has a first and a second line of curvature that, at least in substantial part, are positioned transversely to one another, and along which the individual sections of lens extend; furthermore, that the lines of curvature of one lens section are inclined towards the lines of curvature of the other lens section in terms of their positioning.
US11350682B2
A protective padding section includes an upper layer, an opposing lower layer and a repeating array of cushioning regions disposed between, and continuously bonded to, the upper layer and the lower layer. Each cushioning region has a same first cushion thickness. A repeating array of apertures is disposed between the cushioning regions and each aperture extends through the padding section. The padding section has a first thickness and a first width and upon application of a force, the padding section expands in width from the first width to a second width greater than the first width and when the application of force is removed, the width of the padding section contracts to the first width.
US11350680B2
A leotard having a built-in bra is disclosed. The leotard include a front panel and a back panel. A built-in bra is attached to the front panel of the leotard. A top back strap is attached to the bra at one end, the other end able to receive a fastener disposed on the bra. A bottom back strap is attached to the bra at one end, the other end able to receive a fastener disposed on the bra.
US11350674B2
An electronic cigarette and a method for adjusting the power thereof are provided. The electronic cigarette includes an atomizer and a battery device. The battery device includes a casing, and a controller and a power output module disposed inside the casing. The atomizer is detachably connected to the battery device. The casing is provided with an indication module. The controller is electrically connected to the indication module and the power output module, separately. The controller controls the indication module to alternately issue different indication signals. When the controller detects that the atomizer is connected to the battery device, the controller determines the target output power corresponding to the indication signal currently issued by the indication module according to the pre-stored correspondences between the indication signals and the output powers. When a suction signal is detected, the controller controls the power output module to output the target output power.
US11350672B2
Provided is a device including: a battery configured to supply power; a heater configured to heat an aerosol generating material by receiving power from the battery; a sensor; at least one output unit; and a controller, wherein the controller detects a user's puff by using the sensor and controls at least one output unit based on puff characteristic data based on a result of the detection.
US11350665B2
An electronic smoking device operable in at least two states. A switch is configured to selectively toggle the device between a first state in which a power source provides energy to a first heating element to produce a first vapor of a first flavor, and a second state in which the power source provides energy to a second heating element to produce a second vapor of a second flavor. The controller may operate the device in a most recently toggled state based on detection of the draw by a sensor. The switch may be a non-momentary switch, and may extend through an opening in a casing. An indicator assembly may include indicator lights configured to be selectively illuminated based on the device being in the first or second state. The device may be operable in a third state in which energy is provided to the first and second heating elements.
US11350661B2
An aerosol-cooling element (100) for an aerosol-generating article. The aerosol-cooling element (100) comprises an interior structure (102) and a wrapper material (104) secured around the interior structure (102). The wrapper material (104) comprises a first portion (106) welded to a second portion (108) of the wrapper material (104).
US11350660B2
The present invention relates to an apparatus (100) for crimping a sheet of material (6), the apparatus comprising: a first (9) and a second (10) facing crimping rollers defining a first (1) and a second (22) rotational axis, respectively, the first and second axis being parallel to each other, wherein at least one of the first and second crimping roller includes a plurality of corrugations; an angle changing device, the angle changing device being adapted to change a crimping angle (11) formed between a fixed reference plane (12) and a movable plane (13) containing the first and the second rotational axis.
US11350644B2
Process for manufacturing edible fat continuous emulsions comprising 10 to 85 wt. % of a dispersed water-phase and 15 to 90 wt. % of total fat, said process comprising the steps of: a. providing a water-phase; b. providing liquid oil; c. providing fat powder comprising hardstock fat; d. providing hardstock fat in liquid form; e. mixing fat powder comprising hardstock fat, hardstock fat in liquid form and liquid oil to provide an oil-slurry; f. mixing the oil-slurry provided at step ‘e’ with the water-phase to provide a water-in-oil emulsion, wherein the fat powder is not subjected to temperatures at which a substantial part of the fat powder melts. An edible fat continuous emulsion comprising 10 to 85 wt. % of a dispersed water-phase and 15 to 90 wt. % of total fat, comprising at least 2 wt. %, based on the weight of total fat, of a first hardstock fat with the following solid fat profile: N20 from 65 to 95; N35 from 25 to 55; and further comprising at least 2 wt. %, based on the weight of total fat, of a second hardstock fat with the following solid fat profile: N20 from 5 to 95; N30 below 60, wherein the Quotient-A is from 0.95 to 0.2, and wherein the emulsion has a glossiness-value of at least 4 and a Stevens-value of at least 75, wherein Quotient-A is the FWHM value of an emulsion divided by the FWHM value of the emulsion after rework using a votator process.
US11350641B2
The present invention relates a method for increasing the shelf life of fruit comprising the steps of: treating a fruit with UV light from a UV light source, packaging the fruit in packaging film that allows the fruit to be stored in a modified atmosphere within said film, and storing the packaged fruit.
US11350634B2
A method for preparing a biopesticide preparation for preventing and controlling Solenopsis invicta comprising: a: preparing an agent containing pathogenic microorganisms for preventing and controlling Solenopsis invicta, the agent comprises Beauveria bassiana and sodium chloride, with a Beauveria bassiana spores to sodium chloride ratio of (1-8)×20 billion spores: 4.0-7.5 g; b: placing the agent into a solid container, and adding a corresponding amount of solution in a liquid container; inserting the solid container into the liquid container, wherein a retaining ring is stuck at the opening of the liquid container, a rubber gasket is pressed against the retaining ring, and a lid covers the rubber gasket and the retaining ring and is fixed to the opening of the liquid container.
US11350632B2
A method for killing arthropods may include providing a mineral composition to a substrate that arthropods will contact, wherein the mineral composition is not a carrier for chemical toxin. The mineral composition may include an aluminosilicate particulate, wherein contact between the mineral composition and an arthropod results in death of the arthropod. A composition for killing arthropods may include a mineral composition for associating with a substrate. The mineral composition may include at least one of an aluminosilicate particulate and a diatomaceous earth particulate, wherein the mineral composition is not a carrier for a chemical toxin. The mineral composition may have a median particle size d50 of 10 μm or less. A system for killing arthropods may include a mineral composition including at least one of an aluminosilicate particulate and a diatomaceous earth particulate. The system may further include a substrate, wherein the mineral composition is associated with the substrate.
US11350629B2
A herbicidal composition including trifludimoxazin and at least one herbicide selected from the group consisting of glufosinate, glufosinate-P, and ammonium and sodium salts, wherein a weight ratio of trifludimoxazin to the herbicide is from 1:5 to 1:100.
US11350624B2
An evaporator is provided, for use with a wicked reservoir containing a volatile liquid. The reservoir has a plurality of guide members disposed symmetrically around the wick and extending beyond the height of the wick. The evaporator features a base containing a battery, and a removable cover containing a heater. Attachment of the cover to the base is necessary to establish an electrical connection between the battery and the heater. The guide members fit into recesses in the cover only when the heater and wick are properly aligned, and the heater cannot make electrical connection with the battery unless the guide members and wick are properly aligned with the recesses and heater, respectively.
US11350622B2
A method for plant treatment, including: receiving a first measurement for a plant from a sensor as the sensor moves within a geographic area comprising a plurality of plants; in response to receipt of the first measurement and prior to receipt of a second measurement for a second plant of the plurality, determining a set of treatment mechanism operation parameters for the plant to optimize a geographic area output parameter based on the first measurement and historical measurements for the geographic area; determining an initial treatment parameter for the plant; and operating a treatment mechanism in a treatment mode based on the set of operating parameters in response to satisfaction of the initial treatment parameter.
US11350612B2
The present disclosure provides an improved connection system for use between a baffle and a seed tube of a bird feeder. The seed tube is further comprised of a plurality of tracks to receive a corresponding plurality of latches of the baffle. The tracks are generally L-shaped and have a tapered portion to better receive and compress the latches. The seed tube is also comprised of two recesses, each having a projection therein, the projections positioned on a pivotable surface. The projections of the seed tube are constructed to mate with corresponding openings that are positioned on raised portions of the baffle. Once the projections are inserted into the openings, the connection system is in a locked position and the baffle mates flushly and tightly with the seed tube.
US11350608B1
Apparatus for training horses includes a housing including a lower section under an upper section, the lower section configured with a stall for confining a horse and having opposed sides, and the upper section including a tank for loose granular material and configured with a hopper proximate to each of the sides, the hoppers concurrently openable for releasing the loose granular material into the lower section from above the stall along the respective sides for sufficiently filling the stall with the loose granular material for covering at least a portion of the horse.
US11350598B2
A soybean cultivar designated 97220468 is disclosed. The invention relates to the seeds of soybean cultivar 97220468, to the plants of soybean cultivar 97220468, to the plant parts of soybean cultivar 97220468, and to methods for producing progeny of soybean cultivar 97220468. The invention also relates to methods for producing a soybean plant containing in its genetic material one or more transgenes and to the transgenic soybean plants and plant parts produced by those methods. The invention also relates to soybean cultivars or breeding cultivars, and plant parts derived from soybean cultivar 97220468. The invention also relates to methods for producing other soybean cultivars, lines, or plant parts derived from soybean cultivar 97220468, and to the soybean plants, varieties, and their parts derived from use of those methods. The invention further relates to hybrid soybean seeds, plants, and plant parts produced by crossing cultivar 97220468 with another soybean cultivar.
US11350596B2
A soybean cultivar designated 96050600 is disclosed. The invention relates to the seeds of soybean cultivar 96050600, to the plants of soybean cultivar 96050600, to the plant parts of soybean cultivar 96050600, and to methods for producing progeny of soybean cultivar 96050600. The invention also relates to methods for producing a soybean plant containing in its genetic material one or more transgenes and to the transgenic soybean plants and plant parts produced by those methods. The invention also relates to soybean cultivars or breeding cultivars, and plant parts derived from soybean cultivar 96050600. The invention also relates to methods for producing other soybean cultivars, lines, or plant parts derived from soybean cultivar 96050600, and to the soybean plants, varieties, and their parts derived from use of those methods. The invention further relates to hybrid soybean seeds, plants, and plant parts produced by crossing cultivar 96050600 with another soybean cultivar.
US11350595B2
The invention relates to the soybean variety designated 01077372. Provided by the invention are the seeds, plants and derivatives of the soybean variety 01077372. Also provided by the invention are tissue cultures of the soybean variety 01077372 and the plants regenerated therefrom. Still further provided by the invention are methods for producing soybean plants by crossing the soybean variety 01077372 with itself or another soybean variety and plants produced by such methods.
US11350592B2
According to the invention, there is provided seed and plants of the hybrid corn variety designated CH011157. The invention thus relates to the plants, seeds and tissue cultures of the variety CH011157, and to methods for producing a corn plant produced by crossing a corn plant of variety CH011157 with itself or with another corn plant, such as a plant of another variety. The invention further relates to genetic complements of plants of variety CH011157.
US11350587B2
According to the invention, there is provided seed and plants of the hybrid corn variety designated CH011137. The invention thus relates to the plants, seeds and tissue cultures of the variety CH011137, and to methods for producing a corn plant produced by crossing a corn plant of variety CH011137 with itself or with another corn plant, such as a plant of another variety. The invention further relates to genetic complements of plants of variety CH011137.
US11350585B2
A new watermelon line designated ‘WL0002’ is described. ‘WL0002’ is a watermelon line exhibiting stability and uniformity.
US11350584B1
New lettuce variety designated ‘Airton’ is described. ‘Airton’ is a lettuce variety exhibiting stability and uniformity.
US11350580B2
The invention relates to a device for conducting water in a ground surface, comprising a nonwoven layer introduced into the ground (6), which nonwoven layer has at least one conduit strand (4) provided with passage openings (5) for conducting water. In order to create advantageous construction conditions, it is proposed that the nonwoven layer forms a grid (1) made of intersecting arrays of grid strands and comprises a nonwoven web (3) extending along the conduit strand (4), and that at least one array of grid strands formed of nonwoven strips (2) adjoins the nonwoven web (3).
US11350574B2
A vegetation hanger includes a hanger portion and a crossbar. The hanger portion includes a first aperture, a stem, and a base. The first aperture is configured for handling of the vegetation hanger. The stem includes a first end portion and a second end portion. The stem extends from the first end portion towards the second end portion and defines a second aperture configured for hanging of the vegetation hanger. The crossbar is coupled to the hanger portion and defines a linear plate having a first edge, a second edge, a first end portion, and a second end portion.
US11350571B2
A square baler comprising a gear box configured to receive power from a rotating power source. The baler additionally comprises first and second drive shaft sections extending outwardly from generally opposite sides of the gear box. The gear box is configured to rotate said first and second drive shaft sections using power from the rotating power source. The baler further comprises first and second reciprocating plungers respectively coupled to the first and second drive shaft sections in a manner such that rotation of the first drive shaft section causes reciprocation of the first plunger and rotation of the second drive shaft section causes reciprocation of the second plunger.
US11350566B2
Cutting blades are disclosed for use with a rotary trimmer head assembly with one or more swiveling blade receptacles, where the receptacle has a cylindrical body which defines a passage therethrough for a trimmer blade. The cutting blade preferably has a connecting end portion defining a blade mount aperture adapted to receive the swiveling blade receptacle. A male plug connection member is disposed within the blade mount aperture and preferably has bowed spring arms which are resiliently inwardly deformable, which are urged inwardly upon insertion into the female blade receptacle. The spring arms flex outwardly upon passage through the female receptacle. A multitool retention device is disclosed having a mount aperture end adapted to receive the receptacle and a tool retention end comprising at least one tool retention arm defining an elongated retention slot configured to slidingly receive and retain at least one tool member having a flange at one end of the tool member.
US11350560B1
An independently automated mechanical transplanter assemblage for ejecting plants into the soil is shown and described. The mechanical transplanter includes a plurality of mechanical transplanter units mounted to a frame. Each mechanical transplanter unit will include a plant tray indexing vertically and horizontally for presenting plants to a grabber having a plurality of forks. The grabber and forks thereon will be able to swing into a horizontal position for advancing in a linear motion to grip and retract plants from cells in a tray. The grabber will also be configured to swing the forks into an approximate vertical plane for ejecting each independently held plant down a funnel into a planting shoe for delivery into an open row in the soil. Other embodiments of the device are also disclosed.
US11350557B2
A towed agricultural working tool with a central frame element, a headstock and left and right hand side frame elements connected to the central frame element, each of the side elements supporting at least one processing unit, the central frame element being connected at, at least one connecting location for pivoting movement with respect to the headstock in which one or more friction elements are arranged between the central frame element and the headstock at one of the at least one connecting locations. This has as an advantage that the pivoting movement of the central frame with respect to the headstock, in particular due to induced yaw, is reduced.
US11350553B2
A grouser-cage attachment for equipment is an apparatus that imprints troughs into the soil, specifically troughs oriented perpendicular to a slope to hinder rainfall from running straight down the slope. The apparatus includes a main frame, a roller, and a grouser cage. The main frame connects the roller with a piece of equipment or large machinery such as a skid steer. The roller presses the grouser cage into the soil. The grouser cage further includes a cylindrical frame, a plurality of holes, and a plurality of cleats. The cylindrical frame supports and positions the plurality of cleats around the roller. The cylindrical frame freely rotates around and with the roller. The plurality of holes and the plurality of cleats imprints troughs into the soil. The plurality of holes also provides a smooth and continuous rotation for the grouser cage. The roller presses the plurality of cleats into the soil.
US11357151B2
A component mounting machine performs a mounting operation of mounting an electronic component to a board. The component mounting machine includes: multiple related operation devices each including an electrically-operated section configured to perform a related operation that is an operation related to the mounting operation, and an output section configured to output an operation signal representing a state of the electrically-operated section that is operating; and circuitry configured to limit the quantity of the related operation devices for which the electrically-operated section is in an operating state to a specified quantity or fewer based on whether there is presence of the operation signal of the multiple related operation devices.
US11357145B2
A picking apparatus is configured to pick up a plurality of micro elements. The picking apparatus includes a main body and a plurality of picking portions. The picking portions connect with and protrude from the main body. Each of the picking portions has a first surface. The first surfaces are away from the main body and configured to pick up the micro elements. The main body has a second surface at least partially located between the picking portions. Each of the first surfaces has a first viscosity. The second surface has a second viscosity. The second viscosity is less than the first viscosity.
US11357139B2
A cooling system for a power conversion device may include a cooler upper-part having a plurality of cooling tubes through which cooling water flows and a connecting portion connecting the cooling tubes; one or more power conversion modules mounted between the cooling tubes; a cooling fin plate formed in a plate shape with cooling fins on a side and mounted on a side of the power conversion module such that the cooling fins are mounted in the opposite directions with respect to the power conversion module; and a cooler lower-part mounted between the cooling fin plate and the cooler upper-part, having one or more open holes formed at a portion, and combined with the cooling fin plate by inserting the cooling fins of the cooling fin plate in the open holes.
US11357137B2
The present invention discloses a one-chambered constant pressure apparatus for liquid immersion cooling of servers, which are submerged within a non-conductive coolant maintained in the apparatus. When servers start to operate, a large amount of heat will be dissipated from servers. The coolant is vaporized into a coolant vapor by absorbing heat dissipated from servers, which enables servers to be cooled. The coolant vapor is condensed into a cooling liquid by a condenser. However, in the process of condensation, the rising coolant vapor tends to scatter in all directions resulting in a failure to condense all of the coolant vapor. Therefore, the uncondensed coolant vapor will cause the pressure in the apparatus to gradually rise, which eventually leads to the ineffective cooling of servers. In view of this problem, the disclosed invention provides an enclosed-type condenser for completely condensing all of the coolant vapor, thereby maintaining the constant pressure in the apparatus and ensuring the reliability of the apparatus during operation and the sustainability of the cooling capacity thereof.
US11357131B1
A two-phase liquid immersion cooling system is described in which heat generating computer components cause a dielectric fluid in its liquid phase to vaporize. Advantageously, a pH indicator is employed to monitor the dielectric fluid.
US11357129B2
A mounting system for functionally-coupling a line-replaceable unit with a structural manifold for supplying fluid coolant can comprise a fastener for the line-replaceable unit having a base and a projection. The projection can have a proximal portion and a distal portion, where the fastener is at least partially-threaded along the projection, and a plurality of seals are disposed radially along the projection. A channel can extend along a longitudinal axis of the fastener from the distal portion of the projection toward the proximal portion of the projection. One or more outlets can be disposed along the projection, the one or more outlets providing fluid communication between the channel and an external environment of the fastener. The fastener can be reversibly-coupled to a mating fastener of the structural manifold such that, when coupled, the line-replaceable unit is rigidly coupled to the structural manifold and fluid is able to flow therebetween.
US11357125B2
A medical device includes a hybrid circuitry assembly and a core circuitry support structure. The core circuitry support structure includes a frame defining a cavity configured to receive at least a portion of the hybrid circuitry assembly. An outer surface of the frame is shaped to correspond to an inside surface of a core assembly housing configured to enclose the hybrid circuitry assembly and the core circuitry support structure.
US11357123B2
According to an embodiment, an electronic apparatus includes a printed circuit board including a plurality of devices that include a nonvolatile memory package and a controller package configured to control the nonvolatile memory package, and a housing accommodating the printed circuit board. The housing includes an opening on a surface constituting the housing. An encryption device among the plurality of devices is present in a first region. The first region is a region on the printed circuit board that is not irradiated with light emitted from a light source placed at the opening. The encryption device is a device used for an encryption process of data to be stored into the nonvolatile memory package.
US11357122B2
The invention provides a luminaire comprising a luminaire housing accommodating a driver housing assembly, the driver housing assembly comprising a driver housing and a cable; the driver housing (10) comprising: a terminal block (11) for connecting a cable (30) to a driver; a compartment (12) for receiving the cable (30); a first housing wall (14) adjacent to a second housing wall (24), wherein the first housing wall (14) comprises a first entrance (15) arranged for receiving the cable (30) and the second housing wall (24) comprises a second entrance (25) arranged for receiving the cable (30), and wherein said first housing wall (14) and said second housing wall (24) enclose a part of the compartment (12); a lid (13) for closing the compartment (12) and for in closed position confining the cable (30) in the first entrance (15) or the second entrance (25); wherein the cable is connected to the terminal block, and wherein the cable is received by the driver housing via either the first entrance or the second entrance.
US11357120B2
An enclosure assembly for housing printed circuit boards and related electrical components having a secured faceplate that may be removed by use of a hand tool.
US11357119B1
A method and apparatus include attaching a lighted cup holder to a seating arrangement. The lighted cup holder includes a cup holder body and a light-producing light source, with the cup holder body being attached to the seating arrangement and having a cup receptacle therein, the light-producing source being disposed within the cup receptacle for illuminating the receptacle. A light-sensitive element operatively connected to the light source selectively controls production of light by the light source in such a manner that illumination of the cup holder is provided only under conditions where visibility is reduced to the point that it becomes difficult to locate the cup holder. The light-sensitive element is mounted on a master lighted cup holder and controls illumination of the master lighted cup holder and one or more slave lighted cup holders operatively connected to the master lighted cup holder.
US11357117B2
A display device is disclosed. The display device includes a housing, a flexible display having an upper surface, a lift assembly provided in the housing and coupled to the upper surface of the flexible display screen to extend the flexible display screen outside the housing, a motor provided in the housing and coupled to the lift assembly to raise the flexible display screen, and an elastic member provided adjacent to the upper surface of the flexible display screen, the elastic member configured to apply a vertical force to the upper surface of the flexible display screen.
US11357110B2
Disclosed herein is an electronic component that includes a first conductive layer including a lower electrode and a first inductor pattern, a dielectric film that covers the lower electrode, an upper electrode laminated on the lower electrode through the dielectric film, an insulating layer that covers the first conductive layer, dielectric film, and upper electrode, and a second conductive layer formed on the insulating layer and including a second inductor pattern. The first and second inductor patterns are connected in parallel through via conductors penetrating the insulating layer.
US11357103B1
A system-in-package cellular assembly is disclosed. The assembly may include a main board including a multi-layer printed circuit board. The main board may include one or more through holes and be detachably connectable to an end-product via the one or more through holes and one or more connecting members. The main board may be reversibly, electrically couplable to the end-product via the one or more through holes and the one or more connecting members. The assembly may include an add-on board including one or more through holes and be detachably connectable to the main board via one or more connectors. The add-on board may be reversibly, electrically couplable to the main board via one or more main board surface mount connectors and one or more add-on board surface mount connectors. The add-on board may include at least one of one or more sensors or one or more sensor through holes.
US11357101B2
The disclosed technology relates to a power supply circuit that utilizes an integrated power module that has a first and second power converter disposed on opposite sides of an inductor core. The power supply circuit includes an inductor core comprising a plurality of nano-magnetic layers embedded within a printed circuit board, a first winding disposed on a first outer surface of the inductor core, a second winding disposed on a second outer surface of the inductor core, a first active layer disposed on an outer surface of the first winding, a second active layer disposed on an outer surface of the second winding, a first capacitor tile disposed on an outer surface of the first active layer, and a second capacitor tile disposed on an outer surface of the second active layer.
US11357093B2
A nozzle assembly for generating an atmospheric plasma jet includes an inlet, through which the jet can be introduced into the nozzle assembly, and a channel connected to the inlet so that the plasma jet introduced is conducted through the channel. Multiple nozzle openings are provided in the channel wall along the channel, through which a plasma jet can exit the assembly. The cross section of the channel in the region of a nozzle opening is shaped in such a way that a virtual medial plane runs between a virtual first tangent plane of the cross section through the nozzle opening and a virtual second tangent plane of the cross section opposite thereto and parallel to the first tangent plane divides the cross section into a first cross-sectional area at the nozzle opening. The cross-sectional surface of the first cross-sectional area differs from the cross-sectional surface of the second.
US11357088B2
The present invention relates to a measurement arrangement for detecting aging processes in individual light-emitting diodes which makes it possible to identify, and subsequently to compensate, a loss of brightness in light-emitting diodes. In this context, a relative measurement of brightness intensity is taken. The present invention further relates to a correspondingly set-up method for detecting aging processes in individual light-emitting diodes and to a computer program product comprising control commands which implement the method.
US11357086B2
An apparatus, system, and method for the calibration of LED light sources and more specifically backlight LEDs of control device buttons to achieve color uniformity and to accurately create colors that are consistent from button to button and device to device.
US11357084B2
A controllable lighting device may comprise a drive circuit characterized by one or more cycles and a control circuit configured to control the drive circuit to conduct a load current through a light source of the lighting device. The control circuit may be configured to determine one or more operating parameters of the lighting device during a present cycle of the drive circuit based on a feedback signal indicative of a peak magnitude of the load current conducted through the light source. The control circuit may be able to adjust an average magnitude of the load current conducted through the light source so as to adjust an intensity of the light source towards a target intensity based on the operating parameters.
US11357079B2
A base station and a user equipment with enhanced PDCP duplication are provided. The base station generates at least one RRC message for a user equipment, wherein the at least one RRC message includes a set of multiple activation criteria, and each activation criterion corresponds to one of multiple RLC entities. The base station transmits the at least one RRC message to the user equipment. Multiple logical channels are provided in a MAC layer, each RLC entity corresponds to at least one of the logical channels, each RLC entity corresponds to a working status (activation or deactivation). At least one of the working statuses of the RLC entities is changed due to at least one of the activation criteria being satisfied, and the base station changes a transmission restriction of at least one specific logical channel among the logical channels based on the changed working statuses of the RLC entities.
US11357077B2
A data forwarding method includes receiving, by a session management function network element, information about a first bearer in a first network from an access and mobility management function network element; and sending flow information of a first flow in a second network and forwarding information to the access and mobility management function network element. The flow information indicates a flow for data forwarding, and the forwarding information is used for forwarding the first flow to a tunnel corresponding to the first bearer.
US11357076B2
This document discloses a solution for configuring a radio resource control connection. According to an aspect, a method comprises: storing, in a database, an identifier of a terminal device and a first set of parameters of a first radio resource control connection of a terminal device; retrieving, from the database by using the identifier after the first radio resource control connection has been terminated, the parameters of the first radio resource control connection; and configuring, on the basis of the retrieved parameters of the first radio resource control connection, at least one operational parameter of a second radio resource control connection of the terminal device identified by the identifier.
US11357069B2
Disclosed in the present invention are a wireless communication method and a wireless communication device. An electronic device in communication with a counterpart communication device comprises a processing circuit, the processing circuit being configured to: determine the state of a link between the electronic device and the counterpart communication device by means of measuring a link maintenance message transmitted by the counterpart communication device when a predetermined condition relative to the counterpart communication device is met, but not to transmit a feedback message for the link maintenance message, wherein the link maintenance message is used for confirming that the link is maintained between the electronic device and the counterpart communication device.
US11357066B2
Examples of wireless communication based on link use capabilities of multi-link devices is disclosed. A first multi-link device receives a first physical layer conformance procedure (PLCP) protocol data unit (PPDU) on a first link from a second multi-link device and transmits a second PPDU on the second link based on a link use capability of the second multi-link device and a backoff counter counting down to a predetermined value. A first multi-link device also transmits a PPDU on the first link and the second link at a same start time based on an link idle determination and the backoff counter counting down to a predetermined value.
US11357064B2
A method and apparatus are disclosed from the perspective of an initiating UE (User Equipment) for establishing a one-to-one sidelink communication with a target UE. In one embodiment, the method includes transmitting a first PC5 signalling used for establishing the one-to-one sidelink communication, wherein the first PC5 signalling includes an identity of the target UE and an identity of a V2X (Vehicle-to-Everything) service.
US11357062B2
An exemplary embodiment provides a communication method and an apparatus. The method includes: receiving, by a UCF, a first message from a terminal device, where the first message includes first information and an identifier of the terminal device; learning, by the UCF, of a first service type based on the first message; learning, by the UCF based on the service type and the identifier of the terminal device, of a first NF that serves the terminal device; and sending, by the UCF, the first information to the first NF, where the first information is information that the terminal device sends to the first NF.
US11357058B2
Implementations of the present disclosure relate to a method for transmitting a random access preamble, and a terminal device. The method comprises: performing the i-th transmission of a random access preamble, i being a positive integer greater than 1; and if the i-th transmission of the random access preamble is performed by the same wave beam as the (i−1)-th transmission, incrementing the value of a power ramping counter of the random access preamble by 1.
US11357054B2
Provided are a data transmission method, apparatus and computer readable storage medium. The method includes: sending, by a terminal, a random access preamble to a base station, and receiving a random access response sent by the base station; and sending, by a terminal, a first request message carrying uplink data to the base station.
US11357045B2
One embodiment of the present invention is a method for user equipment transmitting a physical sidelink shared channel (PSSCH) in a wireless communication system, the method for transmitting a PSSCH comprising the steps of: performing sensing on an m number of subframes indicated by upper layer signaling from among an n number of subframes in a sensing window; repeating sensing of the m number of subframes at an interval of the n number of subframes within the sensing window; selecting, as a transmission resource, the m number of subframes from among the n number of subframes within a selection window, on the basis of the result of sensing the m number of subframes; and transmitting the PSSCH through the m number of subframes selected as the transmission resource.
US11357040B2
A user apparatus communicates with a base station apparatus via a radio frame. The user apparatus includes a reception unit configured to receive information related to a RACH configuration table that indicates allocation of RACH resources in the time domain in the radio frame and information used for excluding unavailable RACH resources of the radio frame in the time domain, a control unit configured to identify available RACH resources based on the information related to the RACH configuration table and the information used for excluding unavailable RACH resources, and a transmission unit configured to transmit a preamble to the base station apparatus by using the identified available RACH resources.
US11357027B2
The present disclosure provides an uplink grant-free transmission method in Ultra Reliable & Low Latency Communication (URLLC), a terminal side device and a network side device. The uplink grant-free transmission method includes: receiving a configuration parameter, the configuration parameter including first information indicating a correspondence between time-domain resources for URLLC uplink transmission and identifiers of Hybrid Automatic Repeat reQuest (HARQ) processes; and after the arrival of a URLLC service, transmitting data for the URLLC service using a corresponding HARQ process on an available time-domain resource for the URLLC uplink transmission.
US11357026B2
Various aspects of the present disclosure generally relate to wireless communication. In some aspects, a user equipment may determine that processing or transmission associated with a scheduling request is preempted, and perform one or more scheduling request preemption actions, associated with the scheduling request, based at least in part on determining that the processing or transmission is preempted. Numerous other aspects are provided.
US11357019B2
A telecommunication system and a method for generating a real time connection between a first endpoint and a second endpoint in an IP network using an ICE STUN connectivity check follow a procedure that includes the steps of generating a list of possible connection paths between the first endpoint and the second endpoint, establishing a respective priority for each possible connection path included in the list, and generating the real time connection between the first endpoint and the second endpoint. During this procedure first there is an attempt to generate the real time connection using the highest-priority connection path. If this is not possible, then the system attempts to establish the real connection using the connection path with the next highest priority, until the real time connection is actually established. Furthermore, for each possible connection path, its respective quality-of-service value is determined and is considered when establishing its priority on the list.
US11357016B2
To provide a mechanism in which a plurality of base station devices operated by different operators, respectively, can share a radio resource while cooperating with each other. A base station device includes: a control unit that transmits, to another base station device operated by an operator different from an operator operating the base station device, first configuration information of a first guaranteed resource that is preferentially usable by the base station device among radio resources that are sharable between the operator operating the base station device and the operator operating the other base station device.
US11357010B2
Sensor assisted beam management system and methods for mobile User Equipment (UEs) are disclosed. An embedded rotation sensor may be used to determine orientation, rotating direction and angular speed of the UE. A speed sensor and GPS may also be used to determine location, moving direction and speed of the UE. The sensor outputs may be used by the UE to efficiently select UE beams after movement or to predict when a UE beam should be updated. Beam search and measurement periodicities may also be updated based on UE movements reported by the sensors.
US11357005B2
Systems, methods, and computer-readable media for an integrated Wi-Fi Access Point and cellular network Radio Unit (RU) include a communication system interfacing with a wired network for communicating Wi-Fi traffic and cellular network traffic, the communication system integrating a Wi-Fi Access Point (AP) with a cellular network Radio Unit (RU). The Wi-Fi traffic and cellular network traffic can be processed in the communication system. The communication system can interface with at least one programmable Radio Frequency (RF) front end configured for wireless communication over one or more frequency bands for Wi-Fi traffic and one or more frequency bands for cellular network traffic (e.g., 5G, LTE, Wi-Fi).
US11356992B2
Example communication methods and apparatus are described. One example method includes receiving configuration information of a first control resource set by a terminal device, where the configuration information of the first control resource set includes mapping manner information of the first control resource set. The terminal device determines a mapping manner between a control channel element (CCE) and resource element groups (REGs) in the first control resource set based on the mapping manner information of the first control resource set, wherein a REG in the first control resource set occupies one symbol in time domain and occupies one resource block RB in frequency domain.
US11356990B2
The present invention provides a resource allocation method and device. The method includes: sending, by a base station, a resource allocation parameter to a terminal, where the resource allocation parameter includes a starting narrowband index and a resource position, where the starting narrowband index is used for indicating a narrowband resource and/or a wideband resource for the terminal to establish a physical shared channel. The embodiments of the present invention solve the problem in existing art that resource allocation for physical downlink shared channel (PDSCH)/physical uplink shared channel (PUSCH) only considers a bandwidth limitation of a 1.4 MHz narrowband so that a user equipment (UE) cannot support machine type communications (MTC) applications with a higher data rate, achieving an effect of being capable of supporting MTC traffic with a higher data rate.
US11356989B2
Reporting aperiodic channel state information (A-CSI) via a physical uplink control channel (PUCCH) is disclosed. A UE receives a configuration to report aperiodic channel state information (A-CSI) using physical uplink control channel (PUCCH). The UE can report lightweight A-CSI via short/long PUCCH or may report heavy A-CSI via short/long PUCCH. The UE receives a trigger signal for PUCCH-based A-CSI reporting either by a dedicated downlink grant or by a group common DCI. When triggered via a DCI-based trigger, the PUCCH resource can be either a resource used for HARQ-ACK feedback, e.g., short PUCCH; or a semi-static configured PUCCH resource, e.g., either short PUCCH or long PUCCH. When triggered via a group common DCI-based trigger, the PUCCH resource can be either semi-statically configured, or dynamically indicated.
US11356988B2
Provided is a method of a terminal in a wireless communication system, including determining a value used for determining a size of a resource for transmission of uplink control information (UCI) based on code block group transmission information (CBGTI) included in downlink control information (DCI) for scheduling physical uplink shared control channel (PUSCH) transmission, and determining the size of the resource for transmission of the UCI based on the determined value.
US11356981B2
A wireless device may determine a second reservation period in units of slots based on a first reservation period in milli-second (ms) and a number of sidelink slots within a fixed period. The number of the sidelink slots may be based on a resource pool configuration. The wireless device may transmit a transport block via one or more transmission resources based on the second reservation period.
US11356980B2
A server and a method for event management is provided. The server selects a first event from a plurality of events based on an event selection criteria. The server further transmits a notification, including event data, to a plurality of user devices. The server further receives a first set of responses from a first set of user devices. The server further transmits a request to each of a plurality of end-devices. The request is for procurement of a set of resources required to host the selected first event. The server further receives confirmation information from one or more of the plurality of end-devices based on the transmitted request, and further transmits logistic information related to the selected first event to the first set of user devices based on the received confirmation information.
US11356979B2
Apparatuses and methods for obtaining and providing hybrid automatic repeat request acknowledgement (HARQ-ACK) information. A method for providing HARQ-ACK information includes receiving a configuration for a slot offset value and receiving a physical sidelink shared channel (PSSCH) over a number of sub-channels in a first slot. The PSSCH includes a transport block (TB). The method includes determining a second slot as an earliest slot with resources for transmission of a physical sidelink feedback channel (PSFCH) that is after the first slot by a number of slots equal to the slot offset value. The PSFCH includes the HARQ-ACK information that is in response to reception of the TB. The method further includes transmitting the PSFCH in the second slot.
US11356977B2
Embodiments of the present invention relate to the field of communications methods and technologies, and in particular, to a transmission method and apparatus. The transmission method includes: generating, by a first device, a sequence based on one or more transmission parameters, where the one or more transmission parameters include at least one of the following: a time domain resource type, transmission waveform indication information, subcarrier spacing indication information, device type information, service type indication information, multiple-input multiple-output MIMO parameter information, duplex mode indication information, control channel format indication information, and transmission carrier indication information; generating to-be-transmitted information by using the sequence; and sending the to-be-transmitted information. According to the transmission method and apparatus in the embodiments of the present invention, a new transmission error check mechanism is provided.
US11356967B2
A method based on standalone secondary synchronization signals (SSSs) can include receiving a configuration of an SSS burst at a user equipment (UE) from a base station in a wireless communication network. The SSS burst can include standalone SSSs grouped into SSS sets. Each SSS set can be associated with a beam index. The configuration can indicate frequency and timing locations of the standalone SSSs. The method can further include performing pre-synchronization, radio resource management (RRM) measurement, or cell detection based on the standalone SSSs in the SSS burst.
US11356962B2
In aspects, a user equipment (UE) forms groups of overlapping uplink transmissions among component carriers (CCs), and moves in time all uplink transmissions within a group, except an earliest transmission, to align leading edges. The UE then determines, for each uplink transmission, if a joint timeline is satisfied, and allocates total transmission power depending on whether the timeline is satisfied for all uplink transmissions. In aspects, a base station transmits, to a UE, a transmit power configuration that identifies a reserved power for uplink transmissions of cell groups. The base station then transmits, to the UE, an uplink grant or configuration that identifies a transmission power for a cell group in excess of its reserved power, and receives, from the UE, uplink transmissions that exhibit an allocation of total transmission power according to the reserved power and the transmission power for the cell group in excess of the reserved power.
US11356959B2
Methods, apparatus and computer program for power control. A method implemented in a terminal device comprises performing power control for at least a first type of traffic based on a first parameter configuration of a first power control loop; and performing power control for at least a second type of traffic based on a second parameter configuration of a second control loop, wherein the first parameter configuration of the first power control loop includes at least one parameter different from the second parameter configuration of the second power control loop.
US11356956B2
A wireless device receives a media access control (MAC) activation command indicating activation of a plurality of physical uplink control channel (PUCCH) secondary cell. The wireless device receives, on a secondary cell in the plurality of cells, downlink control information comprising a PUCCH transmit power control (TPC) command. The wireless device calculates, a transmit power of the secondary PUCCH, employing the PUCCH TPC command only if the secondary PUCCH group comprises the secondary cell. The wireless device transmits uplink signals on the secondary PUCCH with the transmit power.
US11356955B2
There is provided a method in a wireless terminal device for a wireless communications network. The wireless terminal device is operable in a mode in which the wireless terminal device is configurable to wake at defined instances to monitor a control channel for control messages from the wireless communications network. The control messages indicate radio resources for a shared channel over which one or more further messages are to be transmitted. The method comprises, while operating in the mode, monitoring for receipt of an indication from a network node operable in the wireless communications network in a time window associated with a particular defined instance. The indication indicates that data is available at the wireless communications network for transmission to the wireless terminal device. The method further comprises, responsive to receipt of the indication, and based on a configuration received from the network node, determining whether to monitor the control channel during the particular defined instance for a control message indicating radio resources for the shared channel, or to monitor the shared channel for one or more further messages using pre-configured radio resources.
US11356951B2
In order to improve the wake-up signal (WUS) detection performance for MTC UE devices, a set of neighboring base stations coordinate to simultaneously transmit a common wake-up signal (CWUS). The CWUS is transmitted from the base stations utilizing a common set of time/frequency resources. A user equipment (UE) device receives the CWUSs from a plurality of the base stations and combines the received CWUSs. In some examples, the UE device coherently combines the received CWUSs. The UE device utilizes the combined CWUSs to determine when the UE device may skip monitoring of the Paging Occasions within a Paging Time Window (PTW) to conserve power.
US11356949B2
Disclosed herein are a signal transmission method, a base station, and a network node. A base station obtains a wake-up capability of a terminal device. The base station determines, according to the wake-up capability, a first time position for sending a power-saving signal. The base station sends the power saving signal to the terminal device on the first time position. The power-saving signal is used for indicating that the second terminal device wakes up or sleeps at a second time position. The wake-up capability includes a first wake-up capability and a second wake-up capability. The wake-up time of the terminal device having the first wake-up capability is longer than the wake-up time of the terminal device having the second wake-up capability. Therefore, by obtaining the wake-up capability of the terminal device and determining, according to the wake-up capability of the terminal device, the time position for sending a power-saving signal, the base station can ensure that the terminal device effectively wakes up or sleeps according to the power saving signal.
US11356948B2
A user equipment (UE) may provide feedback regarding beam pairs used for wake-up signal (WUS) transmissions via uplink resources configured for WUS-based beam management feedback. A correspondence between WUSs and uplink resources for feedback may be semi-statically configured via radio resource control (RRC) signaling, may be dynamically indicated by each WUS, etc. In some examples, uplink resources for different UEs may be distinctive (e.g., UE-specific). In some cases, each beam used to transmit the wake-up message (e.g., each WUS) may have separate uplink resources, or all beams may share the same uplink resource (e.g., or some combination of uplink resources). As such, the UE and base station may identify one or more beams of sufficient quality (e.g., for control channel transmissions during a discontinuous reception (DRX) on-duration) based on the feedback (e.g., beam report) conveyed by the UE via the configured uplink resources for WUS-based fast beam management techniques.
US11356939B2
A method and a device for determining deployment information of a network are disclosed. The method for determining deployment information of a network includes: receiving, by a first network entity, a first message sent by a second network entity, where the first message carries first deployment information, and the first deployment information is deployment information of a network component; and determining, by the first network entity, second deployment information based on the first deployment information, where the second deployment information is deployment information of a network, and the network includes at least one network component. The foregoing solution can improve accuracy of determining deployment information of a network.
US11356934B2
A system described herein may provide a technique for location-based handling of discovery requests in a service-based network in which different instances of network functions (“NFs”) may be deployed in geographically diverse locations. For example, a Network Repository Function (“NRF”) may maintain location information for the various NF instances and may respond to discovery requests by identifying particular NF instances based on locations associated with the discovery requests. For example, such discovery requests may include a “preferred-locality” parameter or some other indication of location associated with the discovery request, based on which the NRF may identify one or more NF instances to provide in response to the discovery request.
US11356929B2
Provided in embodiments of the present invention are an information transmission method and device and a computer-readable storage medium. The method comprises: receiving information associated with a system message, the information associated with the system message indicating whether a carrier on which a synchronization signal block is located is associated with the system message; and processing system information according to the information associated with the system message.
US11356919B2
This disclosure relates to the field of wireless communications technologies, and in particular, to a handover method, including: receiving, by a mobility management network element of a first network, a first handover request sent by an access network, and learning that a terminal device needs to be handed over to a second network; obtaining an identifier of the terminal device based on the first handover request; determining, by the mobility management network element of the first network, a target mobility management network element of the second network based on the identifier of the terminal device; and sending, by the mobility management network element of the first network, a second handover request to the target mobility management network element of the second network, and requesting to hand over the terminal device to the second network.
US11356916B2
An access point that provides a transition recommendation is described. This access point may provide a first WLAN having a first capability. During operation, the access point may associate with the electronic device. Moreover, the access point may determine that the electronic device has a second capability that is different from the first capability. For example, the first capability may include compatibility with a first IEEE 802.11 standard and the second capability may include compatibility with a second IEEE 802.11 standard. Next, the access point may provide the transition recommendation addressed to the electronic device based at least in part on the difference in the first capability and the second capability, where the transition recommendation recommends that the electronic device transition from the first WLAN to a second WLAN that has the second capability.
US11356910B2
A method for managing measurement parameters of cell handover includes: acquiring a target parameter, the target parameter varying along with altitude and may be used for characterizing the parameter of the altitude at which an aircraft is located; determining a target measurement parameter of cell handover according to the target parameter; performing cell handover processing according to the target measurement parameter.
US11356897B2
Apparatuses, methods, and systems are disclosed for measuring access network performance (“ANP”) parameters for a multi-access data connection. One apparatus includes a processor, a first transceiver and a second transceiver that communicate with a mobile communication network via a first access network and a second access network, respectively. The processor establishes a multi-access data connection with the mobile communication network over the first access network and the second access network and receives measurement assistance information. The processor measures at least one ANP parameter using the measurement assistance information and applies a traffic steering rule to uplink data traffic, the traffic steering rule indicating to which of the first and second access networks the uplink data traffic is to be routed based on the measured at least one ANP parameter.
US11356893B2
A method for transmitting, by user equipment, a PDU session establishment request includes: receiving a session management message based on an SSC mode from an SMF through an AMF in a state in which a back-off timer associated with a DNN-based congestion control is in operation, wherein the session management message is associated with a DNN to which the DNN based congestion control is applied; and transmitting a PDU session establishment request to the AMF for establishment of a new PDU session associated with the DNN on the basis of the session management message. The PDU session establishment request includes information for preventing rejection of the PDU session establishment request, and the information for preventing the rejection may be used to make the AMF ignore the DNN-based congestion control and transmit the PDU session establishment request to the SMF associated with the new PDU session.
US11356889B2
A quality of service (QoS) parameter processing method and a system, where the method includes obtaining, by a control plane device, a core network (CN) packet delay budget (PDB) between a first access network device and a first user plane function device, sending, by the control plane device, the CN PDB to the first access network device, determining, by the first access network device, an access network (AN) PDB between a terminal device and the first access network device based on the CN PDB and an end-to-end PDB between the terminal device and the first user plane function device, and scheduling, by the first access network device, an air interface resource between the terminal device and the first access network device based on the AN PDB.
US11356886B2
A method of processing a network slice based congestion, a device and a system thereof are provided. The method includes: receiving a message sent by a network including slice congestion information; and backing off a target network slice corresponding to the slice congestion information, according to the slice congestion information.
US11356881B2
A method for operating a user equipment (UE) for aperiodic channel state information reference signal (CSI-RS) reception comprises receiving aperiodic CSI-RS configuration information including a CSI-RS triggering offset; receiving downlink control information (DCI) via a physical downlink control channel (PDCCH), where the DCI triggers an aperiodic CSI-RS; and determining the CSI-RS triggering offset based on the CSI-RS configuration information, wherein the CSI-RS triggering offset is configured from a first set when μPDCCH<μCSIRS, and the CSI-RS triggering offset is configured from a second set when μPDCCH>μCSIRS, wherein μPDCCH and μCSIRS are subcarrier spacing configurations for the PDCCH and the aperiodic CSI-RS, respectively, and receiving the aperiodic CSI-RS in a slot Ks determined based on the CSI-RS triggering offset, a slot containing the triggering DCI, and the subcarrier spacing configurations (μPDCCH and μCSIRS).
US11356879B2
A frequency measurement method performed by a user equipment (UE) in a wireless communication system is provided. The frequency measurement method includes: receiving a radio resource control (RRC) release message or system information including first frequency measurement configuration information for frequency measurement in an RRC inactive mode; performing frequency measurement in the RRC inactive mode based on the first frequency measurement configuration information; receiving first RRC resume message including an indicator requesting a measurement report in the RRC inactive mode; and transmitting an RRC resume complete message including the measurement report based on the indicator.
US11356877B2
A measurement configuration method, includes receiving measurement trigger information comprising event trigger information or periodic measurement configuration information, and one or a combination of the following information: a measurement quantity (M) that needs to be reported and a measurement quantity (T) for triggering a measurement event; and sorting and reporting beams in a cell based on the measurement quantity (M) that needs to be reported or the measurement quantity (T) for triggering a measurement event.
US11356871B2
A method for a primary user device of a spectrum license used for allowing radio communication in a wireless communication network covering a local area to which the spectrum license is limited, wherein the method comprises: providing at least one spectrum compliance probe within the local area; detecting, using the at least one spectrum compliance probe, within the local area one or both of (i) a first interference caused by a first signal originating from within the local area, wherein the first interference is not allowed by the spectrum license, and (ii) a second interference caused by a second signal originating from outside the local area, wherein the second interference is not allowed by the spectrum license; and controlling the radio communication in response to said detection.
US11356867B1
A Multi-access Edge Computing (MEC) device receives first parameters associated with a user device from a first radio access network (RAN) device. The MEC device performs functions associated with an application being executed by the user device and the MEC device is co-located with the RAN device. The MEC device receives second parameters associated with the user device from a core network device. The MEC device modifies performance of the functions based on the received first and second parameters and provides third parameters associated with the user device to a second RAN device that is co-located with the MEC device for adjusting performance of a network.
US11356866B2
An example access point may comprise a processing resource; and a memory resource storing machine-readable instructions to cause the processing resource to: perform a management system search using a dynamic host configuration protocol (DHCP); determine, in view of the management system search, whether a management system discovered is a controller; and select one of a first role within a centralized local area network and a second role within a distributed local area network based on determining whether the management system is the controller, wherein the first role within the centralized local area network is selected when the management system is the controller.
US11356849B2
A method of authenticating a transponder communicating with a server, including: calculating a one-time password in the transponder with a dedicated algorithm, on the basis of the state of a counter and a physical quantity, such as a transmission delay determined in the transponder during reading by a reading device; transmitting the password to the server by the reading device, which determines a transmission delay of the transponder, and transmitting to the server, in addition to the password, the information about the transmission delay determined in the reading device; decrypting by the dedicated algorithm the password, and checking if the decrypted transmission delay of the received password corresponds to the transmission delay determined by the reading device within a determined temporal margin, and if the state of the counter is different from a received previous state of the counter so as to authenticate the transponder.
US11356848B2
Embodiments of the present invention analyze multiple factors—such as user input events, device motion data, other data from the endpoint, or data from an external system (such as a real-time location system)—to make a probabilistic determination whether a walkaway event has occurred.
US11356840B2
Apparatuses, methods, and systems are disclosed for suspending services in a first network while attached to a second network. One apparatus includes a processor and a transceiver configured to communicate with either a first mobile communication network or a second mobile communication network. The processor uses a first service in the first mobile communication network and determines to suspend the first service in order to use a second service in the second mobile communication network. The transceiver sends a first mobility management message indicating that a first registration and the first service are to be suspended and receives a second message as reply to the first MM message, said second message indicating that the first registration and the first service are successfully suspended. The processor uses the second service in the second core network without using the first service.
US11356838B2
A method in a network node (115) comprises receiving (615, 715, 820, 920, 1015, 1304), from a user equipment (UE) (110) configured in an inactive state (605, 705, 805, 905, 1005), a request to resume a connection as part of a non-access stratum procedure. The method comprises resuming (620, 720, 825, 925, 1020, 1308) the connection in response to the request. The method comprises obtaining (645, 745, 845, 945, 1045, 1312) an indication that signaling associated with the non-access stratum procedure is complete.
US11356814B1
Disclosed are some examples of techniques for decentralized and scalable ranging and positioning of distributed devices. For example, an anchor user equipment (UE) can detect, from initiator user equipments (UEs), respective initiator positioning reference signal (PRS) transmissions associated with respective initiator positioning sessions. Based on the initiator PRS transmissions, one or more characteristics of PRS messaging associated with the initiator positioning sessions can be determined. When the one or more characteristics satisfies a criterion or criteria, the anchor UE can broadcast an anchor PRS transmission indicating initiation of an anchor positioning session by the anchor UE.
US11356813B2
Embodiments monitor items corresponding to a vehicle. Embodiments determine a maximum speed of the vehicle. Embodiments determine a last known first geo-location of a first item, the first geo-location including a first location and corresponding first time and determines a last known second geo-location of a second item, the second geo-location including a second location and corresponding second time. Embodiments determine a reachability radius including a difference between the second time and the first time and multiplying the difference by the maximum speed. Embodiments determine a distance between the first location and the second location and when the distance is greater than the reachability radius, determine that the first item is detached from the second item.
US11356811B2
Methods, devices, and systems for production controls of process sequences in industrial processing of workpieces supported by indoor localization are provided. In one aspect, an indoor location system includes a plurality of mobile transceivers and an analyzer. At least one mobile transceiver is configured to determine a position of a selected mobile transceiver in a three-dimensional space. Each mobile transceiver is spatially assignable to a corresponding object from a group of objects within a framework of process sequences. Each object is movable in one or more dimensions in the three-dimensional space. The analyzer is configured to determine the position of the selected mobile transceiver based at least on run times of electromagnetic signals between the mobile transceivers in a position determination process and to perform tracking of a movement of a target object assigned to the selected mobile transceiver based on the position of the selected mobile transceiver.
US11356804B2
Techniques are discussed herein for efficiently supporting broadcast of location assistance data (AD) in a wireless network to assist in locating a user equipment (UE). A location server (LS) may send some location AD, which may be optionally ciphered, to base stations for broadcast in cells supported by the base stations. Capability information provided by a UE to the LS indicating a level of support by the UE for receiving broadcast AD and supporting ciphering may enable the LS to determine whether, and what type of, additional AD needs to be sent to the UE by point to point means. An LS may use capability information received from a large number of UEs to assist in determining the types of location assistance data to be broadcast and usage of ciphering.
US11356800B2
A method of estimating indoor location of an electronic device is disclosed. The electronic device will detect multiple Wi-Fi signals, each of which originates from a unique Wi-Fi access point in a building. For each of the signals, the system will determine an access point device identifier and a signal strength indicator, retrieve location coordinates for the access point; and various candidate constants to apply to a distance calculation for determining a distance from the electronic device to each of the access points. The system will repeat the distance calculation multiple times for each of the various constants and determine which constant minimizes a loss value. The system will identify a set of coordinates of the electronic device that are associated with the constant that minimizes the loss value, and then use the coordinates to estimate a location of the electronic device within the building.
US11356794B1
Upon an attempt to communicate through an audio input source in a voice session, a determination can be made whether an audio quality received from a user through the audio input source is below an audio quality threshold. In response to determining that the audio quality through the audio input source is below the audio quality threshold, a first voice input can be received from the user from a first position. A second voice input can be received from the user from a second position. A first volume of the first voice input from the first position can be compared to a second volume of the second voice input from the second position. Feedback can be provided to the user indicating whether the user is closer or farther from the audio input source based on the comparison.
US11356791B2
The present disclosure describes a method and a system of panning and vector reproduction of 4 audio channels, which is based on what in this document is defined as a vector panning, which allows audio panning that is not limited to placing sounds on a simple horizontal line, said vector panning, creates an audio image within a panoramic field delimited by X and Y axes. Said audio image is structured on 8 stereo panning lines which in turn allow us to place sounds in at least 25 panning points. The present disclosure comprises a vector audio reproduction equipment, which must have certain specific characteristics for the proper functioning of the disclosure, such as using only mono audio reproduction systems, same which must emit a full frequency range each, among other characters Energetic, which can be positioned in a configuration of specific angles and distances in relation to the listener in 3 different embodiments.
US11356790B2
Provided is a sound image reproduction device, sound image reproduction method, and sound image reproduction program that can support monaural sound sources and is capable of imparting directivity to virtual sound sources in a space. An acoustic signal processing device (sound image reproduction device) 1 that generates virtual sound sources in a space using multiple loudspeakers arranged in a straight line, includes: a focal-point position determination unit 12 that determines the position of each virtual sound source to generate multiple virtual sound sources in a circular arrangement; a filter-coefficient determination unit 13 that calculates an impulse response vector for each loudspeaker by performing an inverse Fourier transform on a driving function for each loudspeaker that is used to generate a virtual sound source at the position of each virtual sound source and in which different weights are given to some of the virtual sound sources; and a convolution calculation unit 14 that calculates the convolution of one inputted acoustic signal with the impulse response vector for each loudspeaker and outputs each acoustic signal to the corresponding the multiple loudspeakers.
US11356789B2
To enable channel setting to be performed easily and accurately to speakers. Thus, provided is a speaker system including: N number of speakers, the N being three or more; and a signal processing device capable of communicating with each speaker. The signal processing device performs processing of recognizing two arrangement reference speakers with reception of notification that a designation operation has been received from a user, from two speakers among the N number of speakers, and processing of acquiring distance information between each speaker. The signal processing device recognizes a relative-position relationship between the N number of speakers, with the two arrangement reference speakers and the distance information between each speaker. Then, the signal processing device automatically sets a channel to each speaker, on the basis of the relative-position relationship recognized.
US11356774B2
A mixing apparatus includes: a first speaker set processing unit to a P-th speaker set processing unit. K-th speaker set processing unit (K being an integer from 1 to P) includes: a mic set processing unit configured to process acoustic signals output by two microphones of a corresponding microphone set and to output a first acoustic signal and a second acoustic signal. The mic set processing unit configured to process acoustic signals output by two microphones of a corresponding microphone set based on an expansion/contraction coefficient for determining an expansion/contraction rate of a sound field, a shift coefficient for determining a shift amount of a sound field, and an attenuation coefficient for determining an attenuation amount of an acoustic signal output by a microphone.
US11356773B2
One embodiment provides a method comprising inputting into a first layer of a neural network at least one data sample of a current displacement of one or more moving components of a loudspeaker and at least one or more other data samples of one or more prior displacements of the one or more moving components. The method comprises generating in the first layer a data vector by applying a nonlinear activation function based on the at least one data sample of the current displacement and the at least one or more other data samples of the one or more prior displacements. The method comprises inputting into a second layer of the neural network the data vector and applying an affine transformation to the data vector. The method comprises outputting a prediction of a current voltage to apply to the loudspeaker based on the affine transformation applied to the data vector.
US11356761B2
A microphone multi-channel integrated device comprises a speaker body which comprises a main cavity structure. A main cavity speaker, a first auxiliary cavity structural member, a main cavity diaphragm assembly and a second auxiliary cavity structural member are mounted in the main cavity structure through mounting holes. A closed main cavity is defined by the main cavity diaphragm assembly, the main cavity speaker, the first auxiliary cavity structural member, the second auxiliary cavity structural member, an upper main cavity sealing cover, a lower main cavity sealing cover and the main cavity structure. Closed auxiliary cavities are defined by the first auxiliary cavity structural member, the second auxiliary cavity structural member and corresponding auxiliary cavity speakers. Sounds are made mellow and rich by means of the three cavities, and the symmetrical arrangement of parts can reduce squeaking of a microphone caused by resonance.
US11356760B2
An audio device includes a thin film material having a capacitive property, the thin film material including an acoustic sheet having a curved shape, in which the acoustic sheet includes a first region that is actively driven by an input signal and a second region that is not actively driven by the input signal and the first region is formed in at least a part of an outside of the second region.
US11356759B2
A display apparatus according to an embodiment of the present disclosure includes a thin plate-shaped display cell that displays image and a plurality of exciters disposed on a back surface of the display cell and causing the display cell to vibrate. The plurality of exciters is such configured that the plurality of exciters is regarded as one exciter when the plurality of exciters generates vibration in the display cell.
US11356752B2
A telecommunications panel includes a panel frame and a ground wire secured to the panel frame. The ground wire extends longitudinally along the panel frame. The ground wire may be arranged such that modular jacks presses against the ground wire when the modular jacks are received in the panel frame. The ground wire can be made of a tin plated conductive material.
US11356748B2
Embodiments of the present disclosure relate to a method, apparatus, and system for slicing live streaming. A method may include: acquiring the live streaming from a live source station server; slicing the live streaming to generate an index file and sliced files of the live streaming; and sending the index file and the sliced files of the live streaming to an object storage server, to cause the object storage server to store the index file and the sliced files of the live streaming.
US11356744B2
According to an embodiment, an image display device includes: a display; a memory storing one or more instructions; and a processor executing the one or more instructions stored in the memory, wherein the processor executes the one or more instructions: to determine whether it is a recommended time for outputting advertisement content, from a user's log data, based on a first trained model using one or more neural networks; to determine a recommended attribute of an advertisement display region from the user's log data, based on a second trained model using the one or more neural networks, when it is determined that it is the recommended time for outputting the advertisement content; and to adjust an attribute of the advertisement display region based on the determined recommended attribute and control the display to output the advertisement content in the attribute-adjusted advertisement display region.
US11356740B2
In some embodiments, a method selects a context for a user account and selects a plurality of collections for an interface. A collection includes a set of videos. The method selects a theme from a plurality of themes for a collection in the plurality of collections based on the context. The plurality of themes apply different display formats to the collection. The method sends an identifier for the theme and information for the collection to a client device being used by the user account to indicate to the interface the theme to use to display the collection with the plurality of collections.
US11356731B1
The disclosure can provide a method, an electronic device, and a storage medium for displaying a video. The method includes: obtaining key content information of a first video, the key content information for indicating a key element region included in the first video; obtaining a second video by processing the first video based on the key content information and a size of a display region, the second video being suitable to the size of the display region, and the second video including the key element region; and displaying the second video in the display region.
US11356725B2
Systems and methods for dynamically adapting quality levels of content is disclosed herein. A content transmission system determines whether to reduce streaming bandwidth of a device that transmits content. In response to determining to reduce the streaming bandwidth, the content transmission system identifies a first plurality of frames of the content based on a first context and a second plurality of frames of the content based on a second context. The content transmission system transmits the first plurality of frames at a first quality level based on the first context and the second plurality of frames at a second quality level that is higher than the first quality level based on the second context.
US11356722B2
An elementary module of a workflow of an audiovisual content distribution system, each content being received by a terminal in the form of a succession of segments, each segment being distributed to the terminal following transmission of a request by terminal and being obtained by an application of a workflow to a portion of content. The elementary module executes a processing of a predefined type and comprises: a variable plurality of processing units available for executing said processing; a scaling module, able to determine, using a first model, a number of processing units to be allocated for an implementation of a set of processing operations requested of said elementary module; and a load management module able to choose, using a second model, for each processing operation requested, one processing unit among processing units allocated by the scaling module for performing processing, each model being a neural network of the deep learning type.
US11356714B2
Systems and methods of emulating a conversation about a thematic content event are disclosed. An exemplary embodiment receives a member dialogue video from a community member who is a member of a plurality of community members, wherein the member dialogue video includes video and audio portions, and wherein the member dialogue video expresses at least one of a personal opinion and a personal viewpoint about the thematic content event; generates dialogue text from the audio portion of each received member dialogue video, wherein the dialogue text comprises words and phrases spoken by the community member in the member dialogue video; receives a modified thematic content event; compares the words and phrases of the dialogue text with the plurality of keywords; and associates at least one portion of the member dialogue video having the words and phrases of the dialogue text that match with the matching keyword of the anchor point.
US11356707B2
Systems, methods, and computer-readable storage media for signaling filters for reference picture resampling are described. One example involves obtaining an encoded video bitstream associated with the video data, identifying a current picture and at least one reference picture from the encoded video bitstream, and identifying signaling data from the encoded video bitstream for the video data, the signaling data including a partial set of coefficient data for at least one filter. A complete set of coefficients (e.g., filter coefficients) is derived for the at least one filter from the partial set of coefficient data and characteristics of the at least one filter, and the current picture is processed using the complete set of coefficients for the at least one filter.
US11356705B2
A method of processing video data comprises obtaining a bitstream and locating intra random access pictures (IRAP) or Gradual Decoder Refresh (GDR) pictures among the encoded pictures in the bitstream. Locating the IRAP or GDR pictures may comprise obtaining, from a picture header Network Abstraction Layer (NAL) unit in the bitstream, a syntax element that indicates that a picture associated with the picture header NAL unit must be either an Intra Random Access Picture (IRAP) or a Gradual Decoder Refresh (GDR) picture. The picture header NAL unit contains syntax elements that apply to all slices of the picture associated with the picture header NAL unit.
US11356702B2
The present disclosure, in a method of decoding a video signal, provides a method including checking whether a transform skip is applied to a current block; acquiring a transform index indicating transform types applied to a horizontal direction and a vertical direction of the current block from among a plurality of predefined transform types from the video signal when the transform skip is not applied to the current block; and performing an inverse primary transform on the current block using the transform types indicated by the transform index, wherein the transform types applied to the horizontal direction and the vertical direction of the current block are determined from among transform types defined according to an intra prediction mode of the current block based on the transform index.
US11356681B2
A method of extracting a sub-bitstream from an encoded video bitstream using at least one processor includes: obtaining an encoded video bitstream, the encoded video bitstream including a plurality of Network Abstraction Layer (NAL) units; obtaining an output layer set list; comparing the NAL units with the output layer set list; and removing NAL units that are not included in the output layer set list.
US11356676B2
A method for coding a video sequence is provided that includes encoding a portion of a picture in the video sequence in lossless coding mode, and signaling a lossless coding indicator in a compressed bit stream, wherein the lossless coding indicator corresponds to the portion of a picture and indicates whether or not the portion of the picture is losslessly coded. A method for decoding a compressed video bit stream is provided that includes determining that lossless coding mode is enabled, decoding a lossless coding indicator from the compressed video bit stream, wherein the lossless coding indicator corresponds to a portion of a picture in the compressed video bit stream and indicates whether or not the portion of the picture is losslessly coded, and decoding the portion of the picture in lossless coding mode when the lossless coding indicator indicates the portion of the picture is losslessly coded.
US11356674B2
According to an embodiment, an encoding device includes an index setting unit and an encoding unit. The index setting unit generates a common index in which reference indices of one or more reference images included in a first index and a second index are sorted in a combination so as not to include a same reference image in accordance with a predetermined scanning order. The first index representing a combination of the one or more reference images referred to by a first reference image. The second index representing a combination of the one or more reference images referred to by a second reference image. The encoding unit encodes the common index.
US11356668B2
A method for decoding a picture based on a cross-component linear model (CCLM) mode includes deriving neighboring luma reference samples of a luma block, deriving down-sampled neighboring luma reference samples, deriving a linear model parameter based on the down-sampled neighboring luma reference samples and the neighboring chroma reference samples, where the neighboring luma reference samples includes top neighboring luma reference samples, and left neighboring luma reference samples, and where when the top boundary of the luma block overlaps with a boundary of a coding tree unit (CTU), the number of the top neighboring luma reference samples used for deriving the down-sampled neighboring luma reference samples among the neighboring luma reference samples is less than that of the left neighboring luma reference samples used for deriving the down-sampled neighboring luma reference samples.
US11356664B2
Provided is a video decoding method including obtaining split information indicating whether to split a current block; when the split information indicates that the current block is split, splitting the current block into at least two lower blocks; obtaining encoding order information indicating an encoding order of the at least two lower blocks of the current block; determining a decoding order of the at least two lower blocks according to the encoding order information; and decoding the at least two lower blocks according to the decoding order.
US11356657B2
Methods and apparatus of Inter prediction for video coding including affine Inter mode are disclosed. In one method, an affine MVP candidate list is generated, wherein the affine MVP candidate list comprises at least one inherited affine MVP derived from a neighbouring block set. Prediction differences of a current control-point MV set associated with the affine motion model are encoded using one predictor selected from the affine MVP candidate list at the video encoder side or the prediction differences of the current control-point MV set associated with the affine motion model are decoded at the video decoder side using one predictor selected from the affine MVP candidate list. In another method, the inherited affine MVP is derived by considering whether at least one of reference picture lists of said at least one neighbouring block includes one reference picture being the same as a current reference picture of the current block.
US11356656B2
To enable detection of occurrence of abnormality in a more preferable manner when the abnormality occurs in signal processing applied to pixel signals. A signal processing device including: a signal processing unit that performs signal processing on pixel signals; and a data generation unit that associates first test data based on first processing, second test data based on second processing, and valid data obtained by performing the second processing on the pixel signals corresponding to a second frame after a first frame to generate frame data corresponding to the second frame, in which, the first processing is the signal processing for generating the valid data in the first frame; the second processing is the signal processing for generating the valid data in the second frame; and presence or absence of abnormality in the signal processing is diagnosed on the basis of the first test data associated with the frame data corresponding to the first frame, and the first test data associated with the frame data corresponding to the second frame.
US11356650B2
A vision system having a telecentric lens. The vision system includes a projector having a non-telecentric pin-hole lens, a camera having a telecentric lens positioned a distance away from the projector, and a processor. The processor controls the camera and the projector and is configured to calibrate the camera and projector.
US11356644B2
An illuminator of the present disclosure includes a light source unit that emits at least one colored light, and emits, for each of the pieces of colored light, light having a plurality of peak wavelengths different from each other, and a diffraction device that includes a plurality of divided areas, and displays, in each of the divided areas, a diffraction pattern that is optimized at a corresponding peak wavelength out of each of the peak wavelengths. The plurality of divided areas allows the light of the plurality of peak wavelengths to enter the plurality of divided areas individually for each of the pieces of colored light.
US11356639B1
This invention is directed to improving communication among people at remote locations, accomplished at low cost, by communication schemes involving “portal” structures, “channels” and “phonos.” The portal structures are mobile and easily deployed to the remote locations, for quick assembly and use, creating an audio-visual immersive communication experience for its users. A portal network architecture includes a plurality of portals located in different remote locations, configured to provide identical spaces that facilitate audio-video, immersive conferencing among users at the various portal sites. The portal interiors include favorable lighting and camera configurations to facilitate display of life-size, realistic, and planar images of the users while maintaining eye contact between them. The “channels” facilitate viewing of landscape or persons from a distance and “phonos” implementations provide an unmediated aural link between different locations, enabling both real-time conversation and transmission of ambient sounds.
US11356634B2
The present application provides a method of processing video data. The method of processing video data includes obtaining a frame of video including M numbers of first pixel groups along a first direction, each of the M numbers of first pixel groups including N numbers of pixels along a second direction, M and N being positive integers; determining Q numbers of first pixel sets for each respective one of the M numbers of first pixel groups; assigning Q numbers of pixels values respectively to the Q numbers of first pixel sets for each respective one of the M numbers of first pixel groups; generating M numbers of second pixel groups respectively for the M numbers of first pixel groups; and obtaining a processed frame of video including the M numbers of second pixel groups along the first direction.
US11356622B1
An image capturing device is provided, which includes a capacitive trans-impedance amplifier (CTIA) unit cell. The CTIA unit cell includes an image detector and a switching network. The image detector is configured to detect light having a first color and light having a second color different from the first color, and to generate a photocurrent in response to detecting the light. The switching network includes a CTIA switch, a CTIA low reset switch, and a CTIA high-reset biasing switch. The CTIA switch sets a first reset level of the CTIA unit cell to a first voltage in response invoking a first switching state of the CTIA low-reset switch and sets a second reset level of the CTIA to a second voltage greater than the first voltage level in response to invoking a second switching state of the CTIA low-reset switch.
US11356615B2
A camera device includes a first IR illuminator that is configured to irradiate a first irradiation range in a capturing area with first IR light, a second IR illuminator that is configured to irradiate a second irradiation range narrower than the first irradiation range in the capturing area with second IR light, and a controller that is configured to obtain a zoom magnification of the lens and controls the irradiation of the first IR light and the second IR light in a case where the zoom magnification is equal to a predetermined zoom magnification. The controller changes a supplied current of the first IR illuminator for the irradiation of the first IR light over a first predetermined time period, and changes a supplied current of the second IR illuminator for the irradiation of the second IR light over a second predetermined time period.
US11356611B2
An image capture apparatus comprising an image sensor is disclosed. When an instruction to shoot a still image has been detected when executing a live view display, the image capture apparatus shoots the still image preferentially, while repeatedly displaying a same image during a period in which the live view display cannot be updated. The image capture apparatus reduces a luminance and/or changes a tone of the image that is repeatedly displayed.
